KEGG   Homo sapiens (human): 2149Help
Entry
2149              CDS       T01001                                 

Gene name
F2R, CF2R, HTR, PAR-1, PAR1, TR
Definition
(RefSeq) coagulation factor II (thrombin) receptor
  KO
K03914  
coagulation factor II (thrombin) receptor
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Complement and coagulation cascades
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Drug target
Vorapaxar: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2149 (F2R)
   04020 Calcium signaling pathway
    2149 (F2R)
   04024 cAMP signaling pathway
    2149 (F2R)
   04151 PI3K-Akt signaling pathway
    2149 (F2R)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2149 (F2R)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2149 (F2R)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2149 (F2R)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2149 (F2R)
   04611 Platelet activation
    2149 (F2R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2149 (F2R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    2149 (F2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13
AA seq 425 aa AA seqDB search
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtggccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagaatcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccatcaataaaagcagtcctctt
caaaaacaacttcctgcattcatctcagaagatgcctccggatatttgaccagctcctgg
ctgacactctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaac
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctgtttgtgtctgtgctcccctttaagatcagc
tattacttttccggcagtgattggcagtttgggtctgaattgtgtcgcttcgtcactgca
gcattttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcactacctgtcatgatgtgctcaatgaa
accctgctcgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccgctgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
gcagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttctgc
atcttcatcatttgcttcggacccacaaacgtcctcctgattgcgcattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtatcttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aaaaagctgttaacttag

DBGET integrated database retrieval system