KEGG   Homo sapiens (human): 2149Help
Entry
2149              CDS       T01001                                 

Gene name
F2R, CF2R, HTR, PAR-1, PAR1, TR
Definition
coagulation factor II (thrombin) receptor
Orthology
K03914  
coagulation factor II (thrombin) receptor
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Complement and coagulation cascades
Regulation of actin cytoskeleton
Drug target
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13
AA seq 425 aa AA seqDB search
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtggccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagaatcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccatcaataaaagcagtcctctt
caaaaacaacttcctgcattcatctcagaagatgcctccggatatttgaccagctcctgg
ctgacactctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaac
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctgtttgtgtctgtgctcccctttaagatcagc
tattacttttccggcagtgattggcagtttgggtctgaattgtgtcgcttcgtcactgca
gcattttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcactacctgtcatgatgtgctcaatgaa
accctgctcgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccgctgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
gcagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttctgc
atcttcatcatttgcttcggacccacaaacgtcctcctgattgcgcattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtatcttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aaaaagctgttaacttag

DBGET integrated database retrieval system