KEGG   Homo sapiens (human): 2150Help
Entry
2150              CDS       T01001                                 

Gene name
F2RL1, GPR11, PAR2
Definition
(RefSeq) F2R like trypsin receptor 1
  KO
K04234  
coagulation factor II (thrombin) receptor-like 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2150 (F2RL1)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    2150 (F2RL1)
 Human Diseases
  Infectious diseases
   05143 African trypanosomiasis
    2150 (F2RL1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    2150 (F2RL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q13
AA seq 397 aa AA seqDB search
MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFS
VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA
DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF
NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL
CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcggagccccagcgcggcgtggctgctgggggccgccatcctgctagcagcctctctc
tcctgcagtggcaccatccaaggaaccaatagatcctctaaaggaagaagccttattggt
aaggttgatggcacatcccacgtcactggaaaaggagttacagttgaaacagtcttttct
gtggatgagttttctgcatctgtcctcactggaaaactgaccactgtcttccttccaatt
gtctacacaattgtgtttgtggtgggtttgccaagtaacggcatggccctgtgggtcttt
cttttccgaactaagaagaagcaccctgctgtgatttacatggccaatctggccttggct
gacctcctctctgtcatctggttccccttgaagattgcctatcacatacatggcaacaac
tggatttatggggaagctctttgtaatgtgcttattggctttttctatggcaacatgtac
tgttccattctcttcatgacctgcctcagtgtgcagaggtattgggtcatcgtgaacccc
atggggcactccaggaagaaggcaaacattgccattggcatctccctggcaatatggctg
ctgattctgctggtcaccatccctttgtatgtcgtgaagcagaccatcttcattcctgcc
ctgaacatcacgacctgtcatgatgttttgcctgagcagctcttggtgggagacatgttc
aattacttcctctctctggccattggggtctttctgttcccagccttcctcacagcctct
gcctatgtgctgatgatcagaatgctgcgatcttctgccatggatgaaaactcagagaag
aaaaggaagagggccatcaaactcattgtcactgtcctggccatgtacctgatctgcttc
actcctagtaaccttctgcttgtggtgcattattttctgattaagagccagggccagagc
catgtctatgccctgtacattgtagccctctgcctctctacccttaacagctgcatcgac
ccctttgtctattactttgtttcacatgatttcagggatcatgcaaagaacgctctcctt
tgccgaagtgtccgcactgtaaagcagatgcaagtatccctcacctcaaagaaacactcc
aggaaatccagctcttactcttcaagttcaaccactgttaagacctcctattga

DBGET integrated database retrieval system