KEGG   Homo sapiens (human): 2151Help
Entry
2151              CDS       T01001                                 

Gene name
F2RL2, PAR-3, PAR3
Definition
coagulation factor II (thrombin) receptor-like 2
Orthology
K04235  
coagulation factor II (thrombin) receptor-like 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2151 (F2RL2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    2151 (F2RL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q13
AA seq 352 aa AA seqDB search
MENDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWTGATITVKIKCPEESASHLHVKN
ATMGYLTSSLSTKLIPAIYLLVFVVGVPANAVTLWMLFFRTRSICTTVFYTNLAIADFLF
CVTLPFKIAYHLNGNNWVFGEVLCRATTVIFYGNMYCSILLLACISINRYLAIVHPFTYR
GLPKHTYALVTCGLVWATVFLYMLPFFILKQEYYLVQPDITTCHDVHNTCESSSPFQLYY
FISLAFFGFLIPFVLIIYCYAAIIRTLNAYDHRWLWYVKASLLILVIFTICFAPSNIILI
IHHANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgatacaaacaacttggcaaagccaaccttacccattaagacctttcgtgga
gctcccccaaattcttttgaagagttccccttttctgccttggaaggctggacaggagcc
acgattactgtaaaaattaagtgccctgaagaaagtgcttcacatctccatgtgaaaaat
gctaccatggggtacctgaccagctccttaagtactaaactgatacctgccatctacctc
ctggtgtttgtagttggtgtcccggccaatgctgtgaccctgtggatgcttttcttcagg
accagatccatctgtaccactgtattctacaccaacctggccattgcagattttcttttt
tgtgttacattgccctttaagatagcttatcatctcaatgggaacaactgggtatttgga
gaggtcctgtgccgggccaccacagtcatcttctatggcaacatgtactgctccattctg
ctccttgcctgcatcagcatcaaccgctacctggccatcgtccatcctttcacctaccgg
ggcctgcccaagcacacctatgccttggtaacatgtggactggtgtgggcaacagttttc
ttatatatgctgccatttttcatactgaagcaggaatattatcttgttcagccagacatc
accacctgccatgatgttcacaacacttgcgagtcctcatctcccttccaactctattac
ttcatctccttggcattctttggattcttaattccatttgtgcttatcatctactgctat
gcagccatcatccggacacttaatgcatacgatcatagatggttgtggtatgttaaggcg
agtctcctcatccttgtgatttttaccatttgctttgctccaagcaatattattcttatt
attcaccatgctaactactactacaacaacactgatggcttatattttatatatctcata
gctttgtgcctgggtagtcttaatagttgcttagatccattcctttattttctcatgtca
aaaaccagaaatcactccactgcttaccttacaaaatag

DBGET integrated database retrieval system