KEGG   Homo sapiens (human): 2158Help
Entry
2158              CDS       T01001                                 

Gene name
F9, F9_p22, FIX, HEMB, P19, PTC, THPH8
Definition
(RefSeq) coagulation factor IX
  KO
K01321  
coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00219  
Hemophilia
H00223  
Inherited thrombophilia
Drug target
Pegnivacogin (DG01399): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2158 (F9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     2158 (F9)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   2158 (F9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq27.1-q27.2
AA seq 461 aa AA seqDB search
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
HKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgtgaacatgatcatggcagaatcaccaggcctcatcaccatctgcctttta
ggatatctactcagtgctgaatgtacagtttttcttgatcatgaaaacgccaacaaaatt
ctgaatcggccaaagaggtataattcaggtaaattggaagagtttgttcaagggaacctt
gagagagaatgtatggaagaaaagtgtagttttgaagaagcacgagaagtttttgaaaac
actgaaagaacaactgaattttggaagcagtatgttgatggagatcagtgtgagtccaat
ccatgtttaaatggcggcagttgcaaggatgacattaattcctatgaatgttggtgtccc
tttggatttgaaggaaagaactgtgaattagatgtaacatgtaacattaagaatggcaga
tgcgagcagttttgtaaaaatagtgctgataacaaggtggtttgctcctgtactgaggga
tatcgacttgcagaaaaccagaagtcctgtgaaccagcagtgccatttccatgtggaaga
gtttctgtttcacaaacttctaagctcacccgtgctgagactgtttttcctgatgtggac
tatgtaaattctactgaagctgaaaccattttggataacatcactcaaagcacccaatca
tttaatgacttcactcgggttgttggtggagaagatgccaaaccaggtcaattcccttgg
caggttgttttgaatggtaaagttgatgcattctgtggaggctctatcgttaatgaaaaa
tggattgtaactgctgcccactgtgttgaaactggtgttaaaattacagttgtcgcaggt
gaacataatattgaggagacagaacatacagagcaaaagcgaaatgtgattcgaattatt
cctcaccacaactacaatgcagctattaataagtacaaccatgacattgcccttctggaa
ctggacgaacccttagtgctaaacagctacgttacacctatttgcattgctgacaaggaa
tacacgaacatcttcctcaaatttggatctggctatgtaagtggctggggaagagtcttc
cacaaagggagatcagctttagttcttcagtaccttagagttccacttgttgaccgagcc
acatgtcttcgatctacaaagttcaccatctataacaacatgttctgtgctggcttccat
gaaggaggtagagattcatgtcaaggagatagtgggggaccccatgttactgaagtggaa
gggaccagtttcttaactggaattattagctggggtgaagagtgtgcaatgaaaggcaaa
tatggaatatataccaaggtatcccggtatgtcaactggattaaggaaaaaacaaagctc
acttaa

DBGET integrated database retrieval system