KEGG   Homo sapiens (human): 216Help
Entry
216               CDS       T01001                                 

Gene name
ALDH1A1, ALDC, ALDH-E1, ALDH1, ALDH11, HEL-9, HEL-S-53e, HEL12, PUMB1, RALDH1
Definition
(RefSeq) aldehyde dehydrogenase 1 family member A1 (EC:1.2.1.36)
  KO
K07249  
retinal dehydrogenase [EC:1.2.1.36]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    216 (ALDH1A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     216 (ALDH1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.13
AA seq 501 aa AA seqDB search
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctcaggcacgccagacttacctgtcctactcaccgatttgaagattcaatat
actaagatcttcataaacaatgaatggcatgattcagtgagtggcaagaaatttcctgtc
tttaatcctgcaactgaggaggagctctgccaggtagaagaaggagataaggaggatgtt
gacaaggcagtgaaggccgcaagacaggcttttcagattggatccccgtggcgtactatg
gatgcttccgagagggggcgactattatacaagttggctgatttaatcgaaagagatcgt
ctgctgctggcgacaatggagtcaatgaatggtggaaaactctattccaatgcatatctg
aatgatttagcaggctgcatcaaaacattgcgctactgtgcaggttgggctgacaagatc
cagggccgtacaataccaattgatggaaatttttttacatatacaagacatgaacctatt
ggtgtatgtggccaaatcattccttggaatttcccgttggttatgctcatttggaagata
gggcctgcactgagctgtggaaacacagtggttgtcaaaccagcagagcaaactcctctc
actgctctccacgtggcatctttaataaaagaggcagggtttcctcctggagtagtgaat
attgttcctggttatgggcctacagcaggggcagccatttcttctcacatggatatagac
aaagtagccttcacaggatcaacagaggttggcaagttgatcaaagaagctgccgggaaa
agcaatctgaagagggtgaccctggagcttggaggaaagagcccttgcattgtgttagct
gatgccgacttggacaatgctgttgaatttgcacaccatggggtattctaccaccagggc
cagtgttgtatagccgcatccaggatttttgtggaagaatcaatttatgatgagtttgtt
cgaaggagtgttgagcgggctaagaagtatatccttggaaatcctctgaccccaggagtc
actcaaggccctcagattgacaaggaacaatatgataaaatacttgacctcattgagagt
gggaagaaagaaggggccaaactggaatgtggaggaggcccgtgggggaataaaggctac
tttgtccagcccacagtgttctctaatgttacagatgagatgcgcattgccaaagaggag
atttttggaccagtgcagcaaatcatgaagtttaaatctttagatgacgtgatcaaaaga
gcaaacaatactttctatggcttatcagcaggagtgtttaccaaagacattgataaagcc
ataacaatctcctctgctctgcaggcaggaacagtgtgggtgaattgctatggcgtggta
agtgcccagtgcccctttggtggattcaagatgtctggaaatggaagagaactgggagag
tacggtttccatgaatatacagaggtcaaaacagtcacagtgaaaatctctcagaagaac
tcataa

DBGET integrated database retrieval system