KEGG   Homo sapiens (human): 2160Help
Entry
2160              CDS       T01001                                 

Gene name
F11, FXI
Definition
coagulation factor XI (EC:3.4.21.27)
Orthology
K01323  
coagulation factor XI [EC:3.4.21.27]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00938  
Factor XI deficiency
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q35
AA seq 625 aa AA seqDB search
MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFT
FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
HGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
TNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattttcttatatcaagtggtacatttcattttatttacttcagtttctggtgaatgt
gtgactcagttgttgaaggacacctgctttgaaggaggggacattactacggtcttcaca
ccaagcgccaagtactgccaggtagtctgcacttaccacccaagatgtttactcttcact
ttcacggcggaatcaccatctgaggatcccacccgatggtttacttgtgtcctgaaagac
agtgttacagaaacactgccaagagtgaataggacagcagcgatttctgggtattctttc
aagcaatgctcacaccaaataagcgcttgcaacaaagacatttatgtggacctagacatg
aagggcataaactataacagctcagttgccaagagtgctcaagaatgccaagaaagatgc
acggatgacgtccactgccactttttcacgtacgccacaaggcagtttcccagcctggag
catcgtaacatttgtctactgaagcacacccaaacagggacaccaaccagaataacgaag
ctcgataaagtggtgtctggattttcactgaaatcctgtgcactttctaatctggcttgt
attagggacattttccctaatacggtgtttgcagacagcaacatcgacagtgtcatggct
cccgatgcttttgtctgtggccgaatctgcactcatcatcccggttgcttgttttttacc
ttcttttcccaggaatggcccaaagaatctcaaagaaatctttgtctccttaaaacatct
gagagtggattgcccagtacacgcattaaaaagagcaaagctctttctggtttcagtcta
caaagctgcaggcacagcatcccagtgttctgccattcttcattttaccatgacactgat
ttcttgggagaagaactggatattgttgctgcaaaaagtcacgaggcctgccagaaactg
tgcaccaatgccgtccgctgccagttttttacctataccccagcccaagcatcctgcaac
gaagggaagggcaagtgttacttaaagctttcttcaaacggatctccaactaaaatactt
cacgggagaggaggcatctctggatacacattaaggttgtgtaaaatggataatgagtgt
accaccaaaatcaagcccaggatcgttggaggaactgcgtctgttcgtggtgagtggccg
tggcaggtgaccctgcacacaacctcacccactcagagacacctgtgtggaggctccatc
attggaaaccagtggatattaacagccgctcactgtttctatggggtagagtcacctaag
attttgcgtgtctacagtggcattttaaatcaatctgaaataaaagaggacacatctttc
tttggggttcaagaaataataatccatgatcagtataaaatggcagaaagcgggtatgat
attgccttgttgaaactggaaaccacagtgaattacacagattctcaacgacccatatgc
ctgccttccaaaggagatagaaatgtaatatacactgattgctgggtgactggatggggg
tacagaaaactaagagacaaaatacaaaatactctccagaaagccaagatacccttagtg
accaacgaagagtgccagaagagatacagaggacataaaataacccataagatgatctgt
gccggctacagggaaggagggaaggacgcttgcaagggagattcgggaggccctctgtcc
tgcaaacacaatgaggtctggcatctggtaggcatcacgagctggggcgaaggctgtgct
caaagggagcggccaggtgtttacaccaacgtggtcgagtacgtggactggattctggag
aaaactcaagcagtgtga

DBGET integrated database retrieval system