KEGG   Homo sapiens (human): 2167Help
Entry
2167              CDS       T01001                                 

Gene name
FABP4, A-FABP, AFABP, ALBP, HEL-S-104, aP2
Definition
fatty acid binding protein 4, adipocyte
Orthology
K08753  
fatty acid-binding protein 4, adipocyte
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2167 (FABP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21
AA seq 132 aa AA seqDB search
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgcttttgtaggtacctggaaacttgtctccagtgaaaactttgatgattat
atgaaagaagtaggagtgggctttgccaccaggaaagtggctggcatggccaaacctaac
atgatcatcagtgtgaatggggatgtgatcaccattaaatctgaaagtacctttaaaaat
actgagatttccttcatactgggccaggaatttgacgaagtcactgcagatgacaggaaa
gtcaagagcaccataaccttagatgggggtgtcctggtacatgtgcagaaatgggatgga
aaatcaaccaccataaagagaaaacgagaggatgataaactggtggtggaatgcgtcatg
aaaggcgtcacttccacgagagtttatgagagagcataa

DBGET integrated database retrieval system