KEGG   Homo sapiens (human): 2168Help
Entry
2168              CDS       T01001                                 

Gene name
FABP1, FABPL, L-FABP
Definition
fatty acid binding protein 1, liver
Orthology
K08750  
fatty acid-binding protein 1, liver
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Fat digestion and absorption
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p11
AA seq 127 aa AA seqDB search
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctccggcaagtaccaactgcagagccaggaaaactttgaagccttcatgaag
gcaatcggtctgccggaagagctcatccagaaggggaaggatatcaagggggtgtcggaa
atcgtgcagaatgggaagcacttcaagttcaccatcaccgctgggtccaaagtgatccaa
aacgaattcacggtgggggaggaatgtgagctggagacaatgacaggggagaaagtcaag
acagtggttcagttggaaggtgacaataaactggtgacaactttcaaaaacatcaagtct
gtgaccgaactcaacggcgacataatcaccaataccatgacattgggtgacattgtcttc
aagagaatcagcaagagaatttaa

DBGET integrated database retrieval system