KEGG   Homo sapiens (human): 2169Help
Entry
2169              CDS       T01001                                 

Gene name
FABP2, FABPI, I-FABP
Definition
fatty acid binding protein 2, intestinal
Orthology
K08751  
fatty acid-binding protein 2, intestinal
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2169 (FABP2)
  Digestive system
   04975 Fat digestion and absorption
    2169 (FABP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q28-q31
AA seq 132 aa AA seqDB search
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgacagcacttggaaggtagaccggagtgaaaactatgacaagttcatggaa
aaaatgggtgttaatatagtgaaaaggaagcttgcagctcatgacaatttgaagctgaca
attacacaagaaggaaataaattcacagtcaaagaatcaagcacttttcgaaacattgaa
gttgtttttgaacttggtgtcacctttaattacaatctagcagacggaactgaactcagg
gggacctggagccttgagggaaataaacttattggaaaattcaaacggacagacaatgga
aacgaactgaatactgtccgagaaattataggtgatgaactagtccagacttatgtatat
gaaggagtagaagccaaaaggatctttaaaaaggattga

DBGET integrated database retrieval system