KEGG   Homo sapiens (human): 2170Help
Entry
2170              CDS       T01001                                 

Gene name
FABP3, FABP11, H-FABP, M-FABP, MDGI, O-FABP
Definition
(RefSeq) fatty acid binding protein 3
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2170 (FABP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2170 (FABP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 2170
NCBI-ProteinID: NP_004093
OMIM: 134651
HGNC: 3557
Ensembl: ENSG00000121769
Vega: OTTHUMG00000003797
Pharos: P05413(Tchem)
UniProt: P05413
Structure
PDB: 

Jmol
Position
1p35.2
AA seq 133 aa AA seqDB search
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc
acaatcatcgaaaagaatggggacattctcaccctaaaaacacacagcaccttcaagaac
acagagatcagctttaagttgggggtggagttcgatgagacaacagcagatgacaggaag
gtcaagtccattgtgacactggatggagggaaacttgttcacctgcagaaatgggacggg
caagagaccacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac
ggcactgcagtttgcactcgcacttatgagaaagaggcatga

DBGET integrated database retrieval system