KEGG   Homo sapiens (human): 2170Help
Entry
2170              CDS       T01001                                 

Gene name
FABP3, FABP11, H-FABP, M-FABP, MDGI, O-FABP
Definition
fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
Orthology
K08752  
fatty acid-binding protein 3, muscle and heart
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2170 (FABP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2170 (FABP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p33-p32
AA seq 133 aa AA seqDB search
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc
acaatcatcgaaaagaatggggacattctcaccctaaaaacacacagcaccttcaagaac
acagagatcagctttaagttgggggtggagttcgatgagacaacagcagatgacaggaag
gtcaagtccattgtgacactggatggagggaaacttgttcacctgcagaaatgggacggg
caagagaccacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac
ggcactgcagtttgcactcgcacttatgagaaagaggcatga

DBGET integrated database retrieval system