KEGG   Homo sapiens (human): 2171Help
Entry
2171              CDS       T01001                                 

Gene name
FABP5, E-FABP, EFABP, KFABP, PA-FABP, PAFABP
Definition
fatty acid binding protein 5 (psoriasis-associated)
Orthology
K08754  
fatty acid-binding protein 5, epidermal
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2171 (FABP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.13
AA seq 135 aa AA seqDB search
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccacagttcagcagctggaaggaagatggcgcctggtggacagcaaaggctttgat
gaatacatgaaggagctaggagtgggaatagctttgcgaaaaatgggcgcaatggccaag
ccagattgtatcatcacttgtgatggtaaaaacctcaccataaaaactgagagcactttg
aaaacaacacagttttcttgtaccctgggagagaagtttgaagaaaccacagctgatggc
agaaaaactcagactgtctgcaactttacagatggtgcattggttcagcatcaggagtgg
gatgggaaggaaagcacaataacaagaaaattgaaagatgggaaattagtggtggagtgt
gtcatgaacaatgtcacctgtactcggatctatgaaaaagtagaataa

DBGET integrated database retrieval system