KEGG   Homo sapiens (human): 2172Help
Entry
2172              CDS       T01001                                 

Gene name
FABP6, I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
Definition
fatty acid binding protein 6, ileal
Orthology
K08755  
fatty acid-binding protein 6, ileal (gastrotropin)
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2172 (FABP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q33.3-q34
AA seq 177 aa AA seqDB search
MKTVTMMMVVEMQALTQVLRAVLSACTWVSRKGDLQRMKQTHKGKPPSSMAFTGKFEMES
EKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESN
IQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagtgacgatgatgatggtggtggagatgcaggcgctgactcaggttctgaga
gctgtgttgtctgcgtgcacatgggtgagccggaaaggagacctgcagagaatgaaacag
acacataaaggaaagcctcccagcagcatggctttcaccggcaagttcgagatggagagt
gagaagaattatgatgagttcatgaagctccttgggatctccagcgatgtaatcgaaaag
gcccgcaacttcaagatcgtcacggaggtgcagcaggatgggcaggacttcacttggtcc
cagcactactccgggggccacaccatgaccaacaagttcactgttggcaaggaaagcaac
atacagacaatggggggcaagacgttcaaggccactgtgcagatggagggcgggaagctg
gtggtgaatttccccaactatcaccagacctcagagatcgtgggtgacaagctggtggag
gtctccaccatcggaggcgtgacctatgagcgcgtgagcaagagactggcctaa

DBGET integrated database retrieval system