KEGG   Homo sapiens (human): 2173Help
Entry
2173              CDS       T01001                                 

Gene name
FABP7, B-FABP, BLBP, FABPB, MRG
Definition
fatty acid binding protein 7, brain
Orthology
K08756  
fatty acid-binding protein 7, brain
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2173 (FABP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q22-q23
AA seq 132 aa AA seqDB search
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKN
TEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTF
GDVVAVRHYEKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggctttctgtgctacctggaagctgaccaacagtcagaactttgatgagtac
atgaaggctctaggcgtgggctttgccactaggcaggtgggaaatgtgaccaaaccaacg
gtaattatcagtcaagaaggagacaaagtggtcatcaggactctcagcacattcaagaac
acggagattagtttccagctgggagaagagtttgatgaaaccactgcagatgatagaaac
tgtaagtctgttgttagcctggatggagacaaacttgttcacatacagaaatgggatggc
aaagaaacaaattttgtaagagaaattaaggatggcaaaatggttatgacccttactttt
ggtgatgtggttgctgttcgccactatgagaaggcataa

DBGET integrated database retrieval system