KEGG   Homo sapiens (human): 2177Help
Entry
2177              CDS       T01001                                 

Gene name
FANCD2, FA-D2, FA4, FACD, FAD, FAD2, FANCD
Definition
Fanconi anemia, complementation group D2
Orthology
K10891  
fanconi anemia group D2 protein
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Disease
H00238  
Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    2177 (FANCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p26
AA seq 1451 aa AA seqDB search
MVSKRRLSKSEDKESLTEDASKTRKQPLSKKTKKSHIANEVEENDSIFVKLLKISGIILK
TGESQNQLAVDQIAFQKKLFQTLRRHPSYPKIIEEFVSGLESYIEDEDSFRNCLLSCERL
QDEEASMGASYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQL
KWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTS
LTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISE
LREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTI
SEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQST
FSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDTYCQQEVVGALVTH
ICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLA
FSKQNEASSHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERA
NLSDEQCTQVTSLLQLVHSCSEQSPQASALYYDEFANLIQHEKLDPKALEWVGHTICNDF
QDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLLPLLFSQDFAKDGGPVTSQES
GQKLVSPLCLAPYFRLLRLCVERQHNGNLEEIDGLLDCPIFLTDLEPGEKLESMSAKERS
FMCSLIFLTLNWFREIVNAFCQETSPEMKGKVLTRLKHIVELQIILEKYLAVTPDYVPPL
GNFDVETLDITPHTVTAISAKIRKKGKIERKQKTDGSKTSSSDTLSEEKNSECDPTPSHR
GQLNKEFTGKEEKTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQL
GPPELLFLLEDLSQKLESMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCVFQLL
TPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQ
PENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMV
ILEKSTASAQNKEKIASLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAI
EEIAGVGVPELINSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQI
HEEKLLYWNMAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKH
REDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNC
REAFWLGNLKNRDLQGEEIKSQNSQESTADESEDDMSSQASKSKATEDGEEDEVSAGEKE
QDSDESYDDSD
NT seq 4356 nt NT seq  +upstreamnt  +downstreamnt
atggtttccaaaagaagactgtcaaaatctgaggataaagagagcctgacagaagatgcc
tccaaaaccaggaagcaaccactttccaaaaagacaaagaaatctcatattgctaatgaa
gttgaagaaaatgacagcatctttgtaaagcttcttaagatatcaggaattattcttaaa
acgggagagagtcagaatcaactagctgtggatcaaatagctttccaaaagaagctcttt
cagaccctgaggagacacccttcctatcccaaaataatagaagaatttgttagtggcctg
gagtcttacattgaggatgaagacagtttcaggaactgccttttgtcttgtgagcgtctg
caggatgaggaagccagtatgggtgcatcttattctaagagtctcatcaaactgcttctg
gggattgacatactgcagcctgccattatcaaaaccttatttgagaagttgccagaatat
ttttttgaaaacaagaacagtgatgaaatcaacatacctcgactcattgtcagtcaacta
aaatggcttgacagagttgtggatggcaaggacctcaccaccaagatcatgcagctgatc
agtattgctccagagaacctgcagcatgacatcatcaccagcctacctgagatcctaggg
gattcccagcacgctgatgtggggaaagaactcagtgacctactgatagagaatacttca
ctcactgtcccaatcctggatgtcctttcaagcctccgacttgacccaaacttcctattg
aaggttcgccagttggtgatggataagttgtcgtctattagattggaggatttacctgtg
ataataaagttcattcttcattccgtaacagccatggatacacttgaggtaatttctgag
cttcgggagaagttggatctgcagcattgtgttttgccatcacggttacaggcttcccaa
gtaaagttgaaaagtaaaggacgagcaagttcctcaggaaatcaagaaagcagcggtcag
agctgtattattctcctctttgatgtaataaagtcagctattagatatgagaaaaccatt
tcagaagcctggattaaggcaattgaaaacactgcctcagtatctgaacacaaggtgttt
gacctggtgatgcttttcatcatctatagcaccaatactcagacaaagaagtacattgac
agggtgctaagaaataagattcgatcaggctgcattcaagaacagctgctccagagtaca
ttctctgttcattacttagttcttaaggatatgtgttcatccattctgtcgctggctcag
agtttgcttcactctctagaccagagtataatttcatttggcagtctcctatacaaatat
gcatttaagttttttgacacgtactgccagcaggaagtggttggtgccttagtgacccat
atctgcagtgggaatgaagctgaagttgatactgccttagatgtccttctagagttggta
gtgttaaacccatctgctatgatgatgaatgctgtctttgtaaagggcattttagattat
ctggataacatatcccctcagcaaatacgaaaactcttctatgttctcagcacactggca
tttagcaaacagaatgaagccagcagccacatccaggatgacatgcacttggtgataaga
aagcagctctctagcaccgtattcaagtacaagctcattgggattattggtgctgtgacc
atggctggcatcatggcggcagacagaagtgaatcacctagtttgacccaagagagagcc
aacctgagcgatgagcagtgcacacaggtgacctccttgttgcagttggttcattcctgc
agtgagcagtctcctcaggcctctgcactttactatgatgaatttgccaacctgatccaa
catgaaaagctggatccaaaagccctggaatgggttgggcataccatctgtaatgatttc
caggatgccttcgtagtggactcctgtgttgttccggaaggtgactttccatttcctgtg
aaagcactgtacggactggaagaatacgacactcaggatgggattgccataaacctcctg
ccgctgctgttttctcaggactttgcaaaagatgggggtccggtgacctcacaggaatca
ggccaaaaattggtgtctccgctgtgcctggctccgtatttccggttactgagactttgt
gtggagagacagcataacggaaacttggaggagattgatggtctactagattgtcctata
ttcctaactgacctggagcctggagagaagttggagtccatgtctgctaaagagcgttca
ttcatgtgttctctcatatttcttactctcaactggttccgagagattgtaaatgccttc
tgccaggaaacatcacctgagatgaaggggaaggtgctcactcggttaaagcacattgta
gaattgcaaataatcctggaaaagtacttggcagtcaccccagactatgtccctcctctt
ggaaactttgatgtggaaactttagatataacacctcatactgttactgctatttcagca
aaaatcagaaagaaaggaaaaatagaaaggaaacaaaaaacagatggcagcaagacatcc
tcctctgacacactttcagaagagaaaaattcagaatgtgaccctacgccatctcataga
ggccagctaaacaaggagttcacagggaaggaagaaaagacatcattgttactacataat
tcccatgcttttttccgagagctggacattgaggtcttctctattctacattgtggactt
gtgacgaagttcatcttagatactgaaatgcacactgaagctacagaagttgtgcaactt
gggccccctgagctgcttttcttgctggaagatctctcccagaagctggagagtatgctg
acacctcctattgccaggagagtcccctttctcaagaacaaaggaagccggaatattgga
ttctcacatctccaacagagatctgcccaagaaattgttcattgtgtttttcaactgctg
accccaatgtgtaaccacctggagaacattcacaactattttcagtgtttagctgctgag
aatcacggtgtagttgatggaccaggagtgaaagttcaggagtaccacataatgtcttcc
tgctatcagaggctgctgcagatttttcatgggctttttgcttggagtggattttctcaa
cctgaaaatcagaatttactgtattcagccctccatgtccttagtagccgactgaaacag
ggagaacacagccagcctttggaggaactactcagccagagcgtccattacttgcagaat
ttccatcaaagcattcccagtttccagtgtgctctttatctcatcagacttttgatggtt
attttggagaaatcaacagcttctgctcagaacaaagaaaaaattgcttcccttgccaga
caattcctctgtcgggtgtggccaagtggggataaagagaagagcaacatctctaatgac
cagctccatgctctgctctgtatctacctggagcacacagagagcattctgaaggccata
gaggagattgctggtgttggtgtcccagaactgatcaactctcctaaagatgcatcttcc
tccacattccctacactgaccaggcatacttttgttgttttcttccgtgtgatgatggct
gaactagagaagacggtgaaaaaaattgagcctggcacagcagcagactcgcagcagatt
catgaagagaaactcctctactggaacatggctgttcgagacttcagtatcctcatcaac
ttgataaaggtatttgatagtcatcctgttctgcatgtatgtttgaagtatgggcgtctc
tttgtggaagcatttctgaagcaatgtatgccgctcctagacttcagttttagaaaacac
cgggaagatgttctgagcttactggaaaccttccagttggacacaaggctgcttcatcac
ctgtgtgggcattccaagattcaccaggacacgagactcacccaacatgtgcctctgctc
aaaaagaccctggaacttttagtttgcagagtcaaagctatgctcactctcaacaattgt
agagaggctttctggctgggcaatctaaaaaaccgggacttgcagggtgaagagattaag
tcccaaaattcccaggagagcacagcagatgagagtgaggatgacatgtcatcccaggcc
tccaagagcaaagccactgaggatggtgaagaagacgaagtaagtgctggagaaaaggag
caagatagtgatgagagttatgatgactctgattag

DBGET integrated database retrieval system