KEGG   Homo sapiens (human): 2180Help
Entry
2180              CDS       T01001                                 

Gene name
ACSL1, ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Definition
acyl-CoA synthetase long-chain family member 1 (EC:6.2.1.3)
Orthology
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    2180 (ACSL1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    2180 (ACSL1)
   00071 Fatty acid degradation
    2180 (ACSL1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    2180 (ACSL1)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    2180 (ACSL1)
   03320 PPAR signaling pathway
    2180 (ACSL1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2180 (ACSL1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2180 (ACSL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2180 (ACSL1)
  Exosomal proteins of breast cancer cells
   2180 (ACSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q35
AA seq 698 aa AA seqDB search
MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQ
SVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEW
LSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDT
LGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQR
CGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAF
VKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQP
TVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHV
GAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGD
IGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAI
VVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHP
ELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcccatgagctgttccggtattttcgaatgccagagctggttgacttccgacag
tacgtgcgtactcttccgaccaacacgcttatgggcttcggagcttttgcagcactcacc
accttctggtacgccacgagacccaaacccctgaagccgccatgcgacctctccatgcag
tcagtggaagtggcgggtagtggtggtgcacgaagatccgcactacttgacagcgacgag
cccttggtgtatttctatgatgatgtcacaacattatacgaaggtttccagaggggaata
caggtgtcaaataatggcccttgtttaggctctcggaaaccagaccaaccctatgaatgg
ctttcatataaacaggttgcagaattgtcggagtgcataggctcagcactgatccagaag
ggcttcaagactgccccagatcagttcattggcatctttgctcaaaatagacctgagtgg
gtgattattgaacaaggatgctttgcttattcgatggtgatcgttccactttatgatacc
cttggaaatgaagccatcacgtacatagtcaacaaagctgaactctctctggtttttgtt
gacaagccagagaaggccaaactcttattagagggtgtagaaaataagttaataccaggc
cttaaaatcatagttgtcatggatgcctacggcagtgaactggtggaacgaggccagagg
tgtggggtggaagtcaccagcatgaaggcgatggaggacctgggaagagccaacagacgg
aagcccaagcctccagcacctgaagatcttgcagtaatttgtttcacaagtggaactaca
ggcaaccccaaaggagcaatggtcactcaccgaaacatagtgagcgattgttcagctttt
gtgaaagcaacagagaatacagtcaatccttgcccagatgatactttgatatctttcttg
cctctcgcccatatgtttgagagagttgtagagtgtgtaatgctgtgtcatggagctaaa
atcggatttttccaaggagatatcaggctgctcatggatgacctcaaggtgcttcaaccc
actgtcttccccgtggttccaagactgctgaaccggatgtttgaccgaattttcggacaa
gcaaacaccacgctgaagcgatggctcttggactttgcctccaagaggaaagaagcagag
cttcgcagcggcatcatcagaaacaacagcctgtgggaccggctgatcttccacaaagta
cagtcgagcctgggcggaagagtccggctgatggtgacaggagccgccccggtgtctgcc
actgtgctgacgttcctcagagcagccctgggctgtcagttttatgaaggatacggacag
acagagtgcactgccgggtgctgcctgaccatgcctggagactggaccgcaggccatgtt
ggggccccgatgccgtgcaatttgataaaacttgttgatgtggaagaaatgaattacatg
gctgccgagggcgagggcgaggtgtgtgtgaaagggccaaatgtatttcagggctacttg
aaggacccagcgaaaacagcagaagctttggacaaagacggctggttacacacaggggac
attggaaaatggttaccaaatggcaccttgaaaattatcgaccggaaaaagcacatattt
aagctggcacaaggagaatacatagcccctgaaaagattgaaaatatctacatgcgaagt
gagcctgttgctcaggtgtttgtccacggagaaagcctgcaggcatttctcattgcaatt
gtggtaccagatgttgagacattatgttcctgggcccaaaagagaggatttgaagggtcg
tttgaggaactgtgcagaaataaggatgtcaaaaaagctatcctcgaagatatggtgaga
cttgggaaggattctggtctgaaaccatttgaacaggtcaaaggcatcacattgcaccct
gaattattttctatcgacaatggccttctgactccaacaatgaaggcgaaaaggccagag
ctgcggaactatttcaggtcgcagatagatgacctctattccactatcaaggtttag

DBGET integrated database retrieval system