KEGG   Homo sapiens (human): 2180Help
Entry
2180              CDS       T01001                                 

Gene name
ACSL1, ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Definition
(RefSeq) acyl-CoA synthetase long chain family member 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    2180 (ACSL1)
   00071 Fatty acid degradation
    2180 (ACSL1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    2180 (ACSL1)
  Cell growth and death
   04216 Ferroptosis
    2180 (ACSL1)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    2180 (ACSL1)
   03320 PPAR signaling pathway
    2180 (ACSL1)
  Environmental adaptation
   04714 Thermogenesis
    2180 (ACSL1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2180 (ACSL1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2180 (ACSL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2180 (ACSL1)
  Exosomal proteins of breast cancer cells
   2180 (ACSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 2180
NCBI-ProteinID: NP_001273637
OMIM: 152425
HGNC: 3569
Ensembl: ENSG00000151726
Vega: OTTHUMG00000160547
Pharos: P33121(Tbio)
UniProt: P33121 A8K9T3
Position
4q35.1
AA seq 698 aa AA seqDB search
MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQ
SVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEW
LSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDT
LGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQR
CGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAF
VKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQP
TVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHV
GAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGD
IGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAI
VVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHP
ELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcccatgagctgttccggtattttcgaatgccagagctggttgacttccgacag
tacgtgcgtactcttccgaccaacacgcttatgggcttcggagcttttgcagcactcacc
accttctggtacgccacgagacccaaacccctgaagccgccatgcgacctctccatgcag
tcagtggaagtggcgggtagtggtggtgcacgaagatccgcactacttgacagcgacgag
cccttggtgtatttctatgatgatgtcacaacattatacgaaggtttccagaggggaata
caggtgtcaaataatggcccttgtttaggctctcggaaaccagaccaaccctatgaatgg
ctttcatataaacaggttgcagaattgtcggagtgcataggctcagcactgatccagaag
ggcttcaagactgccccagatcagttcattggcatctttgctcaaaatagacctgagtgg
gtgattattgaacaaggatgctttgcttattcgatggtgatcgttccactttatgatacc
cttggaaatgaagccatcacgtacatagtcaacaaagctgaactctctctggtttttgtt
gacaagccagagaaggccaaactcttattagagggtgtagaaaataagttaataccaggc
cttaaaatcatagttgtcatggatgcctacggcagtgaactggtggaacgaggccagagg
tgtggggtggaagtcaccagcatgaaggcgatggaggacctgggaagagccaacagacgg
aagcccaagcctccagcacctgaagatcttgcagtaatttgtttcacaagtggaactaca
ggcaaccccaaaggagcaatggtcactcaccgaaacatagtgagcgattgttcagctttt
gtgaaagcaacagagaatacagtcaatccttgcccagatgatactttgatatctttcttg
cctctcgcccatatgtttgagagagttgtagagtgtgtaatgctgtgtcatggagctaaa
atcggatttttccaaggagatatcaggctgctcatggatgacctcaaggtgcttcaaccc
actgtcttccccgtggttccaagactgctgaaccggatgtttgaccgaattttcggacaa
gcaaacaccacgctgaagcgatggctcttggactttgcctccaagaggaaagaagcagag
cttcgcagcggcatcatcagaaacaacagcctgtgggaccggctgatcttccacaaagta
cagtcgagcctgggcggaagagtccggctgatggtgacaggagccgccccggtgtctgcc
actgtgctgacgttcctcagagcagccctgggctgtcagttttatgaaggatacggacag
acagagtgcactgccgggtgctgcctgaccatgcctggagactggaccgcaggccatgtt
ggggccccgatgccgtgcaatttgataaaacttgttgatgtggaagaaatgaattacatg
gctgccgagggcgagggcgaggtgtgtgtgaaagggccaaatgtatttcagggctacttg
aaggacccagcgaaaacagcagaagctttggacaaagacggctggttacacacaggggac
attggaaaatggttaccaaatggcaccttgaaaattatcgaccggaaaaagcacatattt
aagctggcacaaggagaatacatagcccctgaaaagattgaaaatatctacatgcgaagt
gagcctgttgctcaggtgtttgtccacggagaaagcctgcaggcatttctcattgcaatt
gtggtaccagatgttgagacattatgttcctgggcccaaaagagaggatttgaagggtcg
tttgaggaactgtgcagaaataaggatgtcaaaaaagctatcctcgaagatatggtgaga
cttgggaaggattctggtctgaaaccatttgaacaggtcaaaggcatcacattgcaccct
gaattattttctatcgacaatggccttctgactccaacaatgaaggcgaaaaggccagag
ctgcggaactatttcaggtcgcagatagatgacctctattccactatcaaggtttag

DBGET integrated database retrieval system