KEGG   Homo sapiens (human): 2181Help
Entry
2181              CDS       T01001                                 

Gene name
ACSL3, ACS3, FACL3, LACS_3, LACS3, PRO2194
Definition
(RefSeq) acyl-CoA synthetase long chain family member 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    2181 (ACSL3)
   00071 Fatty acid degradation
    2181 (ACSL3)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    2181 (ACSL3)
  Cell growth and death
   04216 Ferroptosis
    2181 (ACSL3)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    2181 (ACSL3)
   03320 PPAR signaling pathway
    2181 (ACSL3)
  Environmental adaptation
   04714 Thermogenesis
    2181 (ACSL3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2181 (ACSL3)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2181 (ACSL3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2181 (ACSL3)
  Exosomal proteins of breast cancer cells
   2181 (ACSL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 2181
NCBI-ProteinID: NP_004448
OMIM: 602371
HGNC: 3570
Ensembl: ENSG00000123983
Vega: OTTHUMG00000133160
Pharos: O95573(Tbio)
UniProt: O95573 A0A024R497
Position
2q36.1
AA seq 720 aa AA seqDB search
MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPV
NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPN
GKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACF
MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK
PPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMIS
HSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQ
SSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQI
SKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTES
AGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYY
KNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAA
LKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLK
VLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccacgtgtcttcaaaaccatctaccatgaagctaaaacataccatcaaccct
attcttttatattttatacattttctaatatcactttatactattttaacatacattccg
ttttattttttctccgagtcaagacaagaaaaatcaaaccgaattaaagcaaagcctgta
aattcaaaacctgattctgcatacagatctgttaatagtttggatggtttggcttcagta
ttataccctggatgtgatactttagataaagtttttacatatgcaaaaaacaaatttaag
aacaaaagactcttgggaacacgtgaagttttaaatgaggaagatgaagtacaaccaaat
ggaaaaatttttaaaaaggttattcttggacagtataattggctttcctatgaagatgtc
tttgttcgagcctttaattttggaaatggattacagatgttgggtcagaaaccaaagacc
aacatcgccatcttctgtgagaccagggccgagtggatgatagctgcacaggcgtgtttt
atgtataattttcagcttgttacattatatgccactctaggaggtccagccattgttcat
gcattaaatgaaacagaggtgaccaacatcattactagtaaagaactcttacaaacaaag
ttgaaggatatagtttctttggtcccacgcctgcggcacatcatcactgttgatggaaag
ccaccgacctggtccgagttccccaagggcatcattgtgcataccatggctgcagtggag
gccctgggagccaaggccagcatggaaaaccaacctcatagcaaaccattgccctcagat
attgcagtaatcatgtacacaagtggatccacaggacttccaaagggagtcatgatctca
catagtaacattattgctggtataactgggatggcagaaaggattccagaactaggagag
gaagatgtctacattggatatttgcctctggcccatgttctagaattaagtgctgagctt
gtctgtctttctcacggatgccgcattggttactcttcaccacagactttagcagatcag
tcttcaaaaattaaaaaaggaagcaaaggggatacatccatgttgaaaccaacactgatg
gcagcagttccggaaatcatggatcggatctacaaaaatgtcatgaataaagtcagtgaa
atgagtagttttcaacgtaatctgtttattctggcctataattacaaaatggaacagatt
tcaaaaggacgtaatactccactgtgcgacagctttgttttccggaaagttcgaagcttg
ctagggggaaatattcgtctcctgttgtgtggtggcgctccactttctgcaaccacgcag
cgattcatgaacatctgtttctgctgtcctgttggtcagggatacgggctcactgaatct
gctggggctggaacaatttccgaagtgtgggactacaatactggcagagtgggagcacca
ttagtttgctgtgaaatcaaattaaaaaactgggaggaaggtggatactttaatactgat
aagccacaccccaggggtgaaattcttattgggggccaaagtgtgacaatggggtactac
aaaaatgaagcaaaaacaaaagctgatttctttgaagatgaaaatggacaaaggtggctc
tgtactggggatattggagagtttgaacccgatggatgcttaaagattattgatcgtaaa
aaggaccttgtaaaactacaggcaggggaatatgtttctcttgggaaagtagaggcagct
ttgaagaatcttccactagtagataacatttgtgcatatgcaaacagttatcattcttat
gtcattggatttgttgtgccaaatcaaaaggaactaactgaactagctcgaaagaaagga
cttaaagggacttgggaggagctgtgtaacagttgtgaaatggaaaatgaggtacttaaa
gtgctttccgaagctgctatttcagcaagtctggaaaagtttgaaattccagtaaaaatt
cgtttgagtcctgaaccgtggacccctgaaactggtctggtgacagatgccttcaagctg
aaacgcaaagagcttaaaacacattaccaggcggacattgagcgaatgtatggaagaaaa
taa

DBGET integrated database retrieval system