KEGG   Homo sapiens (human): 2182Help
Entry
2182              CDS       T01001                                 

Gene name
ACSL4, ACS4, FACL4, LACS4, MRX63, MRX68
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 4
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    2182 (ACSL4)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    2182 (ACSL4)
   00071 Fatty acid degradation
    2182 (ACSL4)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    2182 (ACSL4)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    2182 (ACSL4)
   03320 PPAR signaling pathway
    2182 (ACSL4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2182 (ACSL4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2182 (ACSL4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2182 (ACSL4)
  Exosomal proteins of breast cancer cells
   2182 (ACSL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.3-q23
AA seq 711 aa AA seqDB search
MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYR
SVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLIL
GNYKWMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTL
YATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPE
GFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSK
GDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEV
TDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAED
YSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAM
KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaagctaaatgtgctcaccattattttgctgcctgtccacttgttaataaca
atatacagtgcccttatatttattccatggtattttcttaccaatgccaagaagaaaaac
gctatggcaaagagaataaaagctaagcccacttcagacaaacctggaagtccatatcgc
tctgtcacacacttcgactcactagctgtaatagacatccctggagcagatactctggat
aaattatttgaccatgctgtatccaagtttgggaagaaggacagccttgggaccagggaa
atcctaagtgaagaaaatgaaatgcagccaaatggaaaagtttttaagaagttaattctt
gggaattataaatggatgaactatcttgaagtgaatcgcagagtgaataactttggtagt
ggactcactgcactgggactaaaaccaaagaacaccattgccatcttctgtgagaccagg
gccgaatggatgattgcagcacagacctgctttaagtacaactttcctcttgtgacttta
tatgccacacttggcaaagaagcagtagttcatgggctaaatgaatctgaggcttcctat
ctgattaccagtgttgaacttctggaaagtaaacttaagactgcattgttagatatcagt
tgtgttaaacatatcatttatgtggacaataaggctatcaataaagcagagtaccctgaa
ggatttgagattcacagcatgcaatcagtagaagagttgggatctaacccagaaaacttg
ggcattcctccaagtagaccaacgccttcagacatggccattgttatgtatactagtggt
tctactggccgacctaagggagtgatgatgcatcatagcaatttgatagctggaatgaca
ggccagtgtgaaagaatacctggactgggaccgaaggacacatatattggctacttgcct
ttggctcatgtgctagaactgacagcagagatatcttgctttacctatggctgcaggatt
ggatattcttctccgcttacactctctgaccagtccagcaaaattaaaaaaggaagcaaa
ggagactgtactgtactgaagcccacacttatggctgctgttccggaaatcatggataga
atttataagaatgttatgagcaaagtccaagagatgaattatattcagaaaactctgttc
aagatagggtatgattacaaattggaacagatcaaaaagggatatgatgcacctctttgc
aatctgttactgtttaaaaaggtcaaggccctgctgggagggaatgtccgcatgatgctg
tctggaggggccccgctatctcctcagacacaccgattcatgaatgtctgcttctgctgc
ccaattggccagggttatggactgacagaatcatgtggtgctgggacagttactgaagta
actgactatactactggcagagttggagcacctcttatttgctgtgaaattaagctaaaa
gactggcaagaaggcggttatacaattaatgacaagccaaaccccagaggtgaaatcgta
attggtggacagaacatctccatgggatattttaaaaatgaagagaaaacagcagaagat
tattctgtggatgaaaatggacaaaggtggttttgcactggtgatattggagaattccat
cccgatggatgtttacagattatagatcgtaagaaagatctagtgaagttacaagcagga
gagtatgtatctcttgggaaagtagaagctgcactgaagaattgtccacttattgacaac
atctgtgcttttgccaaaagtgatcagtcctatgtgatcagttttgtggttcctaaccag
aaaaggttgacacttttggcacaacagaaaggggtagaaggaacttgggttgatatctgc
aataatcctgctatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatg
aaattggagcgatttgaaattccaatcaaggttcgattaagcccagagccatggacccct
gaaactggtttggtaactgatgctttcaaactgaaaaggaaggagctgaggaaccattac
ctcaaagacattgaacgaatgtatgggggcaaataa

DBGET integrated database retrieval system