KEGG   Homo sapiens (human): 2185Help
Entry
2185              CDS       T01001                                 

Gene name
PTK2B, CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
Definition
protein tyrosine kinase 2 beta (EC:2.7.10.2)
Orthology
K05871  
focal adhesion kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Chemokine signaling pathway
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
GnRH signaling pathway
Hepatitis B
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2185 (PTK2B)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    2185 (PTK2B)
   04670 Leukocyte transendothelial migration
    2185 (PTK2B)
   04062 Chemokine signaling pathway
    2185 (PTK2B)
  Endocrine system
   04912 GnRH signaling pathway
    2185 (PTK2B)
 Human Diseases
  Infectious diseases
   05161 Hepatitis B
    2185 (PTK2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2185 (PTK2B)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FAK family
   2185 (PTK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p21.1
AA seq 1009 aa AA seqDB search
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagtcgagtaaagttgggcacgttacgccggcctgaa
ggccctgcagagcccatggtggtggtaccagtagatgtggaaaaggaggacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcctgggaaaaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagatcatcacctccatcctgctgagcgggcggatc
gggcccaacatccggttggctgagtgctatgggctgaggctgaagcacatgaagtccgat
gagatccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatccgctacttgccagaagacttc
atggagagcctgaaggaggacaggaccacgctgctctatttttaccaacagctccggaac
gactacatgcagcgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcacttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgccggcttcgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaagggatccgccagctgactagtcaggacgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctcccgctggaggagggccaggcagtactt
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcatccctagcagag
gctgagaacatggctgacctcatagacggctactgccggctgcagggtgagcaccaaggc
tctctcatcatccatcctaggaaagatggtgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtcccacctctcagagagctgcagcatagagtcagac
atctacgcagagattcccgacgaaaccctgcgaaggcccggaggtccacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacaaatcacaaaggggagaaaatcaatgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagctgatcggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctatggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcaccctcgtgctgtactcactgcagatatgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggacgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgacgtctggatgttcgccgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggagaccggctgcccaagcctgatctctgtccaccggtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctggtgtgcagcctcagt
gacgtttatcagatggagaaggacattgccatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacagccttccaggaacccccacccaagcccagccgacct
aagtacagaccccctccgcaaaccaacctcctggctccaaagctgcagttccaggttcct
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccaacccagcagccgagaagaggcccagcagctgtgggaggctgaa
aaggtcaaaatgcggcaaatcctggacaaacagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgacgccagagaaggaggtcggctacctggagttcacagggcccccacagaagcccccg
aggctgggcgcacagtccatccagcccacagctaacctggaccggactgatgacctggtg
tacctcaatgtcatggagctggtgcgggccgtgctggagctcaagaatgagctctgtcag
ctgccccccgagggctacgtggtggtggtgaagaatgtggggctgaccctgcggaagctc
atcgggagcgtggatgatctcctgccttccttgccgtcatcttcacggacagagatcgag
ggcacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgcggctggca
cagcagaacgccgtgacctccctaagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggctgtggacgccaagaacctgctcgacgctgtggaccaggccaaggttctg
gccaatctggcccacccacctgcagagtga

DBGET integrated database retrieval system