KEGG   Homo sapiens (human): 2187Help
Entry
2187              CDS       T01001                                 

Gene name
FANCB, FA2, FAAP90, FAAP95, FAB, FACB
Definition
Fanconi anemia, complementation group B
Orthology
K10889  
fanconi anemia group B protein
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Module
FA core complex
Disease
H00238  
Fanconi anemia
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.2
AA seq 859 aa AA seqDB search
MTSKQAMSSNEQERLLCYNGEVLVFQLSKGNFADKEPTKTPILHVRRMVFDRGTKVFVQK
STGFFTIKEENSHLKIMCCNCVSDFRTGINLPYIVIEKNKKNNVFEYFLLILHSTNKFEM
RLSFKLGYEMKDGLRVLNGPLILWRHVKAFFFISSQTGKVVSVSGNFSSIQWAGEIENLG
MVLLGLKECCLSEEECTQEPSKSDYAIWNTKFCVYSLESQEVLSDIYIIPPAYSSVVTYV
HICATEIIKNQLRISLIALTRKNQLISFQNGTPKNVCQLPFGDPCAVQLMDSGGGNLFFV
VSFISNNACAVWKESFQVAAKWEKLSLVLIDDFIGSGTEQVLLLFKDSLNSDCLTSFKIT
DLGKINYSSEPSDCNEDDLFEDKQENRYLVVPPLETGLKVCFSSFRELRQHLLLKEKIIS
KSYKALINLVQGKDDNTSSAEEKECLVPLCGEEENSVHILDEKLSDNFQDSEQLVEKIWY
RVIDDSLVVGVKTTSSLKLSLNDVTLSLLMDQAHDSRFRLLKCQNRVIKLSTNPFPAPYL
MPCEIGLEAKRVTLTPDSKKEESFVCEHPSKKECVQIITAVTSLSPLLTFSKFCCTVLLQ
IMERESGNCPKDRYVVCGRVFLSLEDLSTGKYLLTFPKKKPIEHMEDLFALLAAFHKSCF
QITSPGYALNSMKVWLLEHMKCEIIKEFPEVYFCERPGSFYGTLFTWKQRTPFEGILIIY
SRNQTVMFQCLHNLIRILPINCFLKNLKSGSENFLIDNMAFTLEKELVTLSSLSSAIAKH
ESNFMQRCEVSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLKVSGALYREITL
KVAEVQLKSDFAAQKLSNL
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgactagcaaacaagcaatgtcatctaacgaacaagaaaggctcttgtgttataatggg
gaagtccttgttttccagttgtctaaaggaaattttgcagataaagagcctacaaaaaca
cccatattacatgtcagaagaatggtatttgacagaggaacaaaagtatttgttcagaag
tccactggattttttaccataaaggaagaaaactctcatttaaaaatcatgtgttgcaac
tgtgtgtcagatttcagaactggaattaacctcccttacattgtgatagaaaaaaataaa
aagaataatgtttttgaatattttttactaatccttcacagtactaataaatttgaaatg
cgtttgagttttaaactaggctatgagatgaaggatggcctaagggtccttaatggccct
ttaattttatggaggcatgtcaaagcattcttctttatctcttctcaaactggcaaagtt
gttagtgtgtcaggtaacttttcctctattcagtgggcaggggagattgaaaatttaggt
atggttttattgggactaaaggaatgttgtttatctgaggaagaatgtactcaagagcct
tcaaaatcagattatgcaatttggaataccaaattttgtgtatattctcttgaaagtcaa
gaagtattaagtgatatatacattattcctcctgcttacagcagtgtggtgacttatgta
catatttgtgcaactgagatcatcaaaaaccagttaagaatatctctcattgcccttact
cgaaagaatcagctgatttcatttcagaatggaactcctaaaaatgtgtgccagcttcca
tttggagatccttgtgcagttcaacttatggattcaggtggaggaaacctctttttcgtt
gtatcctttatatccaataatgcttgtgctgtatggaaagagagctttcaggttgctgct
aaatgggaaaaacttagcttagtactgatagatgactttattggaagtggaactgaacaa
gtactcctactttttaaggactccttgaactcagactgcctgacttcatttaaaataacg
gatcttggaaaaataaactattcgagtgaaccatcagattgcaatgaagatgacttattt
gaagacaaacaagagaatcgttacctggtggttccacctctagaaacaggactgaaagtt
tgtttttcttcttttcgggaattacggcagcatctgttgcttaaggaaaaaattatttca
aaatcttacaaagctttaataaacctagttcaaggaaaagatgataatacgtcaagtgca
gaggagaaggaatgtcttgttcctctttgtggtgaagaagaaaattctgtccatatctta
gatgaaaagttatcagacaattttcaagattcagaacagctagtagagaagatatggtat
cgtgtaatagatgatagcttggttgttggagtgaaaactacatcttctttgaagctgtcc
ctgaatgatgtgactttatcattgttaatggatcaagcccatgactccagatttcggctt
ctaaagtgtcaaaatagggtgattaagttgagtacaaatcctttcccagcaccatacttg
atgccatgtgaaataggattggaagcaaaaagggtcacgttgacccctgatagcaagaaa
gaggaaagctttgtttgtgaacacccatctaagaaagagtgtgtacagataattactgct
gtaacatctctttcaccacttttaacattcagtaaattttgttgcactgtactgctacaa
attatggagagagaaagtggtaactgtcctaaagatcgttatgttgtgtgtggcagagtt
tttttaagtctagaagatctttcaactgggaagtacctactgacatttccaaagaagaaa
cctatagagcacatggaagatctttttgcacttcttgcagcattccataaatcttgtttt
caaatcacatcacccggctatgccctgaattcaatgaaggtgtggctcttagaacatatg
aaatgtgaaataatcaaagaatttccagaagtgtacttttgtgaaagaccgggaagtttc
tatgggacactcttcacttggaaacagagaacaccattcgaagggattttaataatctat
tccaggaatcaaacagttatgttccagtgccttcataatctcatcagaattctccctata
aactgtttcctcaaaaatctaaaatcaggaagtgagaatttcctaattgataatatggca
tttactttggagaaggaactagtcacccttagttctctttcttctgccatagctaaacat
gaaagcaattttatgcagaggtgtgaagtgagcaaaggaaagagtagtgtcgtcgcggct
gctttatcagacagaagggaaaatatccatccctacagaaaagaacttcagagagaaaag
aagaaaatgttgcaaacgaacctaaaagtgagtggtgccctttacagagaaataactttg
aaagtagctgaggttcagttgaaatcagactttgctgcacagaaactgagtaatttataa

DBGET integrated database retrieval system