KEGG   Homo sapiens (human): 219428Help
Entry
219428            CDS       T01001                                 

Gene name
OR4C16, OR11-135
Definition
(RefSeq) olfactory receptor family 4 subfamily C member 16 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219428 (OR4C16)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219428 (OR4C16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 219428
NCBI-ProteinID: NP_001004701
HGNC: 15172
Ensembl: ENSG00000279514
Vega: OTTHUMG00000165198
Pharos: Q8NGL9(Tdark)
UniProt: Q8NGL9
Position
11q11
AA seq 310 aa AA seqDB search
MQLNNNVTEFILLGLTQDPFWKKIVFVIFLRLYLGTLLGNLLIIISVKTSQALKNPMFFF
LFYLSLSDTCLSTSITPRMIVDALLKKTTISFSECMIQVFSSHVFGCLEIFILILTAVDR
YVDICKPLHYMTIISQWVCGVLMAVAWVGSCVHSLVQIFLALSLPFCGPNVINHCFCDLQ
PLLKQACSETYVVNLLLVSNSGAICAVSYVMLIFSYVIFLHSLRNHSAEVIKKALSTCVS
HIIVVILFFGPCIFMYTCLATVFPMDKMIAVFYTVGTSFLNPVIYTLKNTEVKSAMRKLW
SKKLITDDKR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaataataatgtgactgagttcattctgcttggattgacacaggatcctttt
tggaagaaaatagtgtttgttatttttttgcgtctctacttgggaacactgttgggtaat
ttgctaatcattattagtgtcaagaccagccaggcacttaagaacccaatgttcttcttc
cttttctacttatccttatctgatacttgcctctctacttccataacccctagaatgatt
gtggatgcccttttgaagaagacaactatctccttcagcgagtgcatgatccaagtcttt
tcatcccatgtctttggctgcctggagatcttcatcctcatcctcacggctgttgaccgc
tatgtggacatctgtaagcccctgcactacatgaccatcataagccagtgggtctgtggt
gttttgatggctgtggcctgggtgggatcctgtgtgcattctttagttcagatttttctt
gccctgagtttgccattctgtggccccaatgtgatcaatcactgtttctgtgacttgcag
cccttgttgaaacaagcctgttcagaaacctatgtggttaacctactcctggtttccaat
agtggggccatttgtgcagtgagttatgtcatgctaatattctcctatgtcatcttcttg
cattctctgagaaaccacagtgctgaagtgataaagaaagcactttccacatgtgtctcc
cacatcattgtggtcatcttgttctttggaccttgcatatttatgtacacatgccttgca
accgtattccccatggataagatgatagctgtattttatacagttggaacatcttttctc
aaccctgtgatttacacgctgaagaatacagaagtgaaaagtgccatgaggaagctttgg
agcaagaaattgatcacagatgacaaaagataa

DBGET integrated database retrieval system