KEGG   Homo sapiens (human): 219436Help
Entry
219436            CDS       T01001                                 

Gene name
OR5D14, OR11-141, OR11-150
Definition
(RefSeq) olfactory receptor family 5 subfamily D member 14
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219436 (OR5D14)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219436 (OR5D14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219436
NCBI-ProteinID: NP_001004735
HGNC: 15281
Ensembl: ENSG00000186113
Vega: OTTHUMG00000166809
Pharos: Q8NGL3(Tdark)
UniProt: Q8NGL3
Position
11q11
AA seq 314 aa AA seqDB search
MMMVLRNLSMEPTFALLGFTDYPKLQIPLFLVFLLMYVITVVGNLGMIIIIKINPKFHTP
MYFFLSHLSFVDFCYSSIVTPKLLENLVMADKSIFYFSCMMQYFLSCTAVVTESFLLAVM
AYDRFVAICNPLLYTVAMSQRLCALLVAGSYLWGMFGPLVLLCYALRLNFSGPNVINHFF
CEYTALISVSGSDILIPHLLLFSFATFNEMCTLLIILTSYVFIFVTVLKIRSVSGRHKAF
STWASHLTSITIFHGTILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVK
DAFWKLIHTQVPFH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggttttaaggaatctgagcatggagcccacctttgcccttttaggtttcaca
gattacccaaagcttcagattcctctcttccttgtgtttctgctcatgtatgttatcaca
gtggtaggaaaccttgggatgatcataataatcaagattaaccccaaatttcacactcct
atgtactttttccttagtcacctctcttttgttgatttttgttactcttccattgtcact
cccaagctgcttgagaacttggtaatggcagataaaagcatcttctactttagctgcatg
atgcagtacttcctgtcctgcactgctgtggtgacagagtctttcttgctggcagtgatg
gcctatgaccgctttgtggccatctgcaatcctctgctttatacagtggccatgtcacag
aggctctgtgccctgctggtggctgggtcatatctctggggcatgtttggccccttggta
ctcctttgttatgctctccggttaaacttctctggacctaatgtaatcaaccacttcttt
tgtgagtatactgctctcatctctgtgtctggctctgatatactcatcccccacctgctg
cttttcagcttcgccaccttcaatgagatgtgtacactactgatcatcctcacttcctat
gttttcatttttgtgactgtactaaaaatccgttctgttagtgggcgccacaaagccttc
tccacctgggcctcccacctgacttctatcaccatcttccatgggaccatccttttcctt
tactgtgtacccaactccaaaaactctcggcaaacagtcaaagtggcctctgtattttac
acagttgtcaaccccatgctgaaccctctgatctacagcctaaggaataaagacgtgaag
gatgctttctggaagttaatacatacacaagttccatttcactga

DBGET integrated database retrieval system