KEGG   Homo sapiens (human): 219438Help
Entry
219438            CDS       T01001                                 

Gene name
OR5D18, OR11-143
Definition
olfactory receptor, family 5, subfamily D, member 18
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q11
AA seq 313 aa AA seqDB search
MLLTDRNTSGTTFTLLGFSDYPELQVPLFLVFLAIYNVTVLGNIGLIVIIKINPKLHTPM
YFFLSQLSFVDFCYSSIIAPKMLVNLVVKDRTISFLGCVVQFFFFCTFVVTESFLLAVMA
YDRFVAICNPLLYTVNMSQKLCVLLVVGSYAWGVSCSLELTCSALKLCFHGFNTINHFFC
EFSSLLSLSCSDTYINQWLLFFLATFNEISTLLIVLTSYAFIVVTILKMRSVSGRRKAFS
TCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKD
TVTEILDTKVFSY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgactgatagaaatacaagtgggaccacgttcaccctcttgggcttctcagat
tacccagaactgcaagtcccactcttcctggtttttctggccatctacaatgtcactgtg
ctagggaatattgggttgattgtgatcatcaaaatcaaccccaaactgcatacccccatg
tactttttcctcagccaactctcctttgtggatttctgctattcctccatcattgctccc
aagatgttggtgaaccttgttgtcaaagacagaaccatttcatttttaggatgcgtagta
caattctttttcttctgtacctttgtggtcactgaatcctttttattagctgtgatggcc
tatgaccgcttcgtggccatttgcaaccctctgctctacacagttaacatgtcccagaaa
ctctgcgtgctgctggttgtgggatcctatgcctggggagtctcatgttccttggaactg
acgtgctctgctttaaagttatgttttcatggtttcaacacaatcaatcacttcttctgt
gagttctcctcactactctccctttcttgctctgatacttacatcaaccagtggctgcta
ttctttcttgccacctttaatgaaatcagcacactactcatcgttctcacatcttatgcg
ttcattgttgtaaccatcctcaagatgcgttcagtcagtgggcgccgcaaagccttctcc
acctgtgcctcccacctgactgccatcaccatcttccatggcaccatcctcttcctttac
tgtgtgcccaactccaaaaactccaggcacacagtcaaagtggcctctgtgttttacacc
gtggtgatccccatgttgaatcccctgatctacagtctgagaaataaagatgtcaaggat
acagtcaccgagatactggacaccaaagtcttctcttactga

DBGET integrated database retrieval system