KEGG   Homo sapiens (human): 219482Help
Entry
219482            CDS       T01001                                 

Gene name
OR5M3, OR11-191
Definition
(RefSeq) olfactory receptor family 5 subfamily M member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219482 (OR5M3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219482 (OR5M3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF2254
Motif
Other DBs
NCBI-GeneID: 219482
NCBI-ProteinID: NP_001004742
HGNC: 14806
Ensembl: ENSG00000174937
Vega: OTTHUMG00000166875
Pharos: Q8NGP4(Tdark)
UniProt: Q8NGP4
Position
11q12.1
AA seq 307 aa AA seqDB search
MLNFTDVTEFILLGLTSRREWQVLFFIIFLVVYIITMVGNIGMMVLIKVSPQLNNPMYFF
LSHLSFVDVWFSSNVTPKMLENLLSDKKTITYAGCLVQCFFFIALVHVEIFILAAMAFDR
YMAIGNPLLYGSKMSRVVCIRLITFPYIYGFLTSLAATLWTYGLYFCGKIEINHFYCADP
PLIKMACAGTFVKEYTMIILAGINFTYSLTVIIISYLFILIAILRMRSAEGRQKAFSTCG
SHLTAVIIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKKAMM
KVISRSC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatttcaccgatgtgacagagttcattcttttggggctaacgagccgtcgagaa
tggcaagttctcttcttcatcatctttcttgtggtctacatcatcaccatggtgggcaat
atcggcatgatggtgttaatcaaggtcagtcctcagcttaacaaccccatgtactttttc
ctcagtcacttgtcatttgttgatgtgtggttttcttccaatgtcacccctaaaatgttg
gaaaacctgttatcagataaaaaaacaattacttatgctggttgtttagtacagtgtttc
ttcttcattgctcttgtccatgtggaaatttttattcttgctgcgatggcctttgataga
tacatggcaattgggaatcctctgctttatggcagtaaaatgtcaagggttgtctgtatt
cgactgattactttcccttacatttatggttttctgacgagtctggcagcaacattatgg
acttacggcttgtacttctgtggaaaaattgagatcaaccatttctactgtgcagatcca
cctctcatcaaaatggcctgtgctgggacctttgtaaaagaatatacaatgatcatactt
gccggcattaacttcacatattccctgactgtaattatcatctcttacttattcatcctc
attgccattctgcgaatgcgctcagcagaaggaaggcagaaggccttttccacatgtggg
tcccatctgacagctgtcattatattctatggtactctgatcttcatgtatctcagacgt
cccacagaggagtctgtggagcaggggaagatggtggctgtgttctataccacagtgatc
cccatgttgaatcccatgatctacagtctgaggaacaaggatgtgaaaaaggccatgatg
aaagtgatcagcagatcatgttaa

DBGET integrated database retrieval system