KEGG   Homo sapiens (human): 219493Help
Entry
219493            CDS       T01001                                 

Gene name
OR5AR1, OR11-209
Definition
(RefSeq) olfactory receptor family 5 subfamily AR member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219493 (OR5AR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219493 (OR5AR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Popeye
Motif
Other DBs
NCBI-GeneID: 219493
NCBI-ProteinID: NP_001004730
HGNC: 15260
Ensembl: ENSG00000172459
Vega: OTTHUMG00000154213
Pharos: Q8NGP9(Tdark)
UniProt: Q8NGP9 A0A126GVM6
Position
11q12.1
AA seq 310 aa AA seqDB search
MDKENSSMVTEFIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADFLTNHKVISFSSCATQFAFFVGFVDAECYVLAAMAY
GRFVAICRPLHYSTFMSKQVCLALMLGSYLAGLVSLVAHTTLTFSLSYCGSNIINHFFCE
IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYTFILVAIIRMRSAEGRLKAFST
CGSHLTGITLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAA
FKKLIGKKSQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggataaagaaaacagctcaatggtgactgagtttatcttcatgggcatcacccaggac
cctcagatggagatcatcttcttcgtggtcttcctcatagtttacctggttaatgtagtg
gggaatattggtatgattatcctgattacaacagacactcagcttcacacacccatgtat
tttttcctctgcaacctctcctttgttgacctgggctactcctcagccattgcccccagg
atgctggctgacttcctaacaaatcacaaagttatctccttctccagctgtgccacccag
tttgctttttttgtaggttttgtggatgctgagtgctatgtcctggcagccatggcctat
ggtcgttttgtggccatttgtcgacccctccactatagcaccttcatgtccaagcaggtc
tgcttggctctcatgctgggctcttacctggctggtctagtgagtttagtagcccacact
accctcaccttcagcctgagttactgtggttccaatatcatcaatcatttcttctgcgaa
atcccaccactcttggccctctcttgctcagacacctacatcagtgagatcttgctcttc
agtctgtgtggcttcattgaattcagcaccatcctcatcatcttcatctcctataccttt
atccttgttgcaatcatcagaatgcgttcagctgaaggccgccttaaggctttctccacc
tgcgggtctcaccttactggcatcaccctcttctatggcacagtcatgtttatgtacctg
aggccaacatccagctactccctggaccaagacaagtgggcctctgtgttctacacggtt
atcatccccatgttaaatcccttgatctacagtttgcggaacaaggatgtgaaagctgct
ttcaaaaagctaattggaaaaaaatctcaataa

DBGET integrated database retrieval system