KEGG   Homo sapiens (human): 2195Help
Entry
2195              CDS       T01001                                 

Gene name
FAT1, CDHF7, CDHR8, FAT, ME5, hFat1
Definition
(RefSeq) FAT atypical cadherin 1
  KO
K16506  
protocadherin Fat 1/2/3
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2195 (FAT1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  FATs
   FAT1_2_3; protocadherin Fat 1/2/3 [KO:K16506]
    2195 (FAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q35
AA seq 4588 aa AA seqDB search
MGRHLALLLLLLLLFQHFGDSDGSQRLEQTPLQFTHLEYNVTVQENSAAKTYVGHPVKMG
VYITHPAWEVRYKIVSGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KALEKNTNVEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSM
AKLTVHIEQANECAPVITAVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLL
QQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
KAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYSHLRYVFKSTPGKAKFSLNYNTGLI
SILEPVKRQQAAHFELEVTTSDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGT
TVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYIN
ITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTL
PTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPL
DRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSE
IIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQ
AREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSG
QVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEV
EVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGVG
VFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTS
EPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTS
RKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
DRERNARREPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKRFSAAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVI
SVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILT
QVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVDQDEKNKLIYTLQSSRDPL
SLKKFRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAP
WFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFMIDPVLGSIK
TAKELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETV
SIGSFVGMVTAHSQSSVVYEIKDGNTGDAFDINPHSGTIITQKALDFETLPIYTLIIQGT
NMAGLSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADAD
KDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAE
YAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITE
GNIGEKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFAGLTSVKINVKESKESHLKFT
QDVYSAVVKENSTEAETLAVITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTGTPFD
REQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVI
RYVTAVDRDSGRNGEVHYYLKEHHEHFQIGPLGEISLKKQFELDTLNKEYLVTVVAKDGG
NPAFSAEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITD
GDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVDDINDNP
PVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTG
LISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARIS
EHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNLHRHALKPF
YSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGD
SGIYGHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFC
TVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSE
SVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSPSKESVVLVYVKILPPEMQL
PKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRL
KLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVE
NLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKR
DNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAIL
STTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYLLTITATD
GTFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITY
TLLGSGAEKFKLNPDTGELKTSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVND
NAPEFSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQFSINELSGI
IQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVS
EDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHE
YYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMAD
DADGPSNSHIHYSIIDGNQGSSFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPR
VNTTTVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTI
VTGNDEKAFEVNPQGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESI
YPPAILPLEIFITSSGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGGKLI
AHKKLDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLNHTIAIRFANLTPEEFVGDYW
RNFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVT
DIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVC
LCKEGRCPPVHHGCEDDPCPEGSECVSDPWEEKHTCVCPSGRFGQCPGSSSMTLTGNSYV
KYRLTENENKLEMKLTMRLRTYSTHAVVMYARGTDYSILEIHHGRLQYKFDCGSGPGIVS
VQSIQVNDGQWHAVALEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIRQQG
TRHGRSPQVGNGFRGCMDSIYLNGQELPLNSKPRSYAHIEESVDVSPGCFLTATEDCASN
PCQNGGVCNPSPAGGYYCKCSALYIGTHCEISVNPCSSKPCLYGGTCVVDNGGFVCQCRG
LYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECSGNPCLHGA
LCENTHGSYHCNCSHEYRGRHCEDAAPNQYVSTPWNIGLAEGIGIVVFVAGIFLLVVVFV
LCRKMISRKKKHQAEPKDKHLGPATAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSI
PSDSRNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSPSDS
DSIQKPSWDFDYDTKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDNG
YHWDTSDWMPSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPE
DFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSE
PQTKGTGENSTCREPHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVSACCEVESEVM
MSDYESGDDGHFEEVTIPPLDSQQHTEV
NT seq 13767 nt NT seq  +upstreamnt  +downstreamnt
atggggagacatttggctttgctcctgcttctgctccttctcttccaacattttggagac
agtgatggcagccaacgacttgaacagactcctctgcagtttacacacctcgagtacaac
gtcaccgtgcaggagaactctgcagctaagacttatgtggggcatcctgtcaagatgggt
gtttacattacacatccagcgtgggaagtaaggtacaaaattgtttccggagacagtgaa
aacctgttcaaagctgaagagtacattctcggagacttttgctttctaagaataaggacc
aaaggaggaaatacagctattcttaatagagaagtgaaggatcactacacattgatagtg
aaagcacttgaaaaaaatactaatgtggaggcgcgaacaaaggtcagggtgcaggtgctg
gatacaaatgacttgagaccgttattctcacccacctcatacagcgtttctttacctgaa
aacacagctataaggaccagtatcgcaagagtcagcgccacggatgcagacataggaacc
aacggggaattttactacagttttaaagatcgaacagatatgtttgctattcacccaacc
agtggtgtgatagtgttaactggtagacttgattacctagagaccaagctctatgagatg
gaaatcctcgctgcggaccgtggcatgaagttgtatgggagcagtggcatcagcagcatg
gccaagctaacggtgcacatcgaacaggccaatgaatgtgctccggtgataacagcagtg
acattgtcaccatcagaactggacagggacccagcatatgcaattgtgacagtggatgac
tgcgatcagggtgccaatggtgacatagcatctttaagcatcgtggcaggtgaccttctc
cagcagtttagaacagtgaggtcctttccagggagtaaggagtataaagtcaaagccatc
ggtggcattgattgggacagtcatcctttcggctacaatctcacactacaggctaaagat
aaaggaactccgccccagttctcttctgttaaagtcattcacgtgacttctccacagttc
aaagccgggccagtcaagtttgaaaaggatgtttacagagcagaaataagtgaatttgct
cctcccaacacacctgtggtcatggtaaaggccattcctgcttattcccatttgaggtat
gtttttaaaagtacacctggaaaagctaaattcagtttaaattacaacactggtctcatt
tctattttagaaccagttaaaagacagcaggcagcccattttgaacttgaagtaacaaca
agtgacagaaaagcgtccaccaaggtcttggtgaaagtcttaggtgcaaatagcaatccc
cctgaatttacccagacagcgtacaaagctgcttttgatgagaacgtgcccattggtact
actgtcatgagcctgagtgccgtagaccctgatgagggtgagaacgggtacgtgacatac
agtatcgcaaatttaaatcatgtgccgtttgcgattgaccatttcactggtgccgtgagt
acgtcagaaaacctggactacgaactgatgcctcgggtttatactctgaggattcgtgca
tcagactggggcttgccgtaccgccgggaagtcgaagtccttgctacaattactctcaat
aacttgaatgacaacacacctttgtttgagaaaataaattgtgaagggacaattcccaga
gatctaggcgtgggagagcaaataaccactgtttctgctattgatgcagatgaacttcag
ttggtacagtatcagattgaagctggaaatgaactggatttctttagtttaaaccccaac
tcgggggtattgtcattaaagcgatcgctaatggatggcttaggtgcaaaggtgtctttc
cacagtctgagaatcacagctacagatggagaaaattttgccacaccattatatatcaac
ataacagtggctgccagtcacaagctggtaaacttgcagtgtgaagagactggtgttgcc
aaaatgctggcagagaagctcctgcaggcaaataaattacacaaccagggagaggtggag
gatattttcttcgattctcactctgtcaatgctcacataccgcagtttagaagcactctt
ccgactggtattcaggtaaaggaaaaccagcctgtgggttccagtgtaattttcatgaac
tccactgaccttgacactggcttcaatggaaaactggtctatgctgtttctggaggaaat
gaggatagttgcttcatgattgatatggaaacaggaatgctgaaaattttatctcctctt
gaccgtgaaacaacagacaaatacaccctgaatattaccgtctatgaccttgggataccc
cagaaggctgcgtggcgtcttctacatgtcgtggttgtcgatgccaatgataatccaccc
gagtttttacaggagagctattttgtggaagtgagtgaagacaaggaggtacatagtgaa
atcatccaggttgaagccacagataaagacctggggcccaacggacacgtgacgtactca
attgttacagacacagacacattttcaattgacagcgtgacgggtgttgttaacatcgca
cgccctctggatcgagagctgcagcatgagcactccttaaagattgaggccagggaccaa
gccagagaagagcctcagctgttctccactgtcgttgtgaaagtatcactagaagatgtt
aatgacaacccacctacatttattccacctaattatcgtgtgaaagtccgagaggatctt
ccagaaggaaccgtcatcatgtggttagaagcccacgatcctgatttaggtcagtctggt
caggtgagatacagccttctggaccacggagaaggaaacttcgatgtggataaactcagt
ggagcagttaggatcgtccagcagttggactttgagaagaagcaagtgtataatctcact
gtgagggccaaagacaagggaaagccagtttctctgtcttctacttgctatgttgaagtt
gaggtggttgatgtgaatgagaacctgcacccacccgtgttttccagctttgtggaaaag
gggacagtgaaagaagatgcacctgttggttcattggtaatgacggtgtcggctcatgat
gaggacgccagaagagatggggagatccgatactccattagagatggctctggcgttggt
gttttcaaaataggtgaagagacaggtgtcatagagacgtcagatcgactggaccgtgaa
tcgacctcccattattggctaacagtctttgcaaccgatcagggtgtcgtgcctctttca
tcgttcatagagatctacatagaggttgaggatgtcaatgacaatgcaccacagacatca
gagcctgtttattacccagaaatcatggaaaattctcctaaagatgtatctgtggtccag
atcgaggcatttgatccagattcgagctctaatgacaagctcatgtacaaaattacaagt
ggaaatccacaaggattcttttcaatacatcctaaaacaggtctcatcacaactacgtca
aggaagctagaccgagaacagcaagatgaacacatattagaggttactgtgacagacaat
ggtagtccccccaaatcaaccattgcaagagtcattgtgaaaatccttgatgaaaatgac
aacaaacctcagtttctgcaaaagttctacaaaatcagactccctgagcgggaaaagcca
gaccgagaaagaaatgccagacgggagccgctctatcacgtcatagccaccgacaaggat
gagggccccaatgcagaaatctcctacagcatcgaagacgggaatgagcatggcaaattt
ttcatcgaaccgaaaactggagtggtttcgtccaagaggttttcagcagctggagaatat
gatattctttcaattaaggcagttgacaatggtcgccctcaaaagtcatcaaccaccaga
ctccatattgaatggatctccaagcccaaaccgtccctggagcccatttcatttgaagaa
tcattttttacctttactgtgatggaaagtgaccccgttgctcacatgattggagtaata
tctgtggagcctcctggcatacccctttggtttgacatcactggtggcaactacgacagt
cacttcgatgtggacaagggaactggaaccatcattgttgccaaacctcttgatgcagaa
cagaagtcaaactacaacctcacagtcgaggctacagatggaaccaccactatcctcact
caggtattcatcaaagtaatagacacaaatgaccatcgtcctcagttttctacatcaaag
tatgaagttgttattcctgaagatacagcgccagaaacagaaattttgcaaatcagtgct
gtggatcaggatgagaaaaacaaactaatctacactctgcagagcagtagagatccactg
agtctcaagaaatttcgtcttgatcctgcaaccggctctctctatacttctgagaaactg
gatcatgaagctgttcaccagcacaccctcacggtcatggtacgagatcaagatgtgcct
gtaaaacgcaactttgcaaggattgtggtcaatgtcagcgacacgaatgaccacgccccg
tggttcaccgcttcctcctacaaagggcgggtttatgaatcggcagccgttggctcagtt
gtgttgcaggtgacggctctggacaaggacaaagggaaaaatgctgaagtgctgtactcg
atcgagtcaggaaatattggaaattcttttatgattgatcctgtcttgggctctattaaa
actgccaaagaattagatcgaagtaaccaagcggagtatgatttaatggtaaaagctaca
gataagggcagtccaccaatgagtgaaataacttctgtgcgtatctttgtcacaattgct
gacaacgcctctccgaagtttacatcaaaagaatattctgttgaacttagtgaaactgtc
agcattgggagtttcgttgggatggttacagcccatagtcaatcatcagtggtgtatgaa
ataaaagatggaaatacaggtgatgcttttgatattaatccacattctggaactatcatc
actcagaaagccctggactttgaaactttgcccatttacacattgataatacaaggaact
aacatggctggtttgtccactaatacaacggttctagttcacttgcaggatgagaatgac
aacgcgccagtttttatgcaggcagaatatacaggactcattagtgaatcagcctcaatt
aacagcgtggtcctaacagacaggaatgtcccactggtgattcgagcagctgatgctgat
aaagactcaaatgctttgcttgtatatcacattgttgaaccatctgtacacacatatttt
gctattgattctagcactggtgctattcatacagtactaagtctggactatgaagaaaca
agtatttttcactttaccgtccaagtgcatgacatgggaaccccacgtttatttgctgag
tatgcagcgaatgtaacagtacatgtaattgacattaatgactgcccccctgtgtttgcc
aagccattatatgaagcatctcttttgttaccaacatacaaaggagtaaaagtcatcaca
gtaaatgctacagatgctgattcaagtgcattctcacagttgatttactccatcaccgaa
ggcaacatcggggagaagttttctatggactacaagactggtgctctcactgtccaaaac
acaactcagttaagaagccgctacgagctaaccgttagagcttccgatggcagatttgcc
ggccttacctctgtcaaaattaatgtgaaagaaagcaaagaaagtcacctaaagtttacc
caggatgtctactctgcggtagtgaaagagaattccaccgaggccgaaacattagctgtc
attactgctattgggaatccaatcaatgagcctttgttttatcacatcctcaacccagat
cgcagatttaaaataagccgcacttcaggagttctgtcaaccactggcacgcccttcgat
cgtgagcagcaggaggcgtttgatgtggttgtagaagtgacagaggaacataagccttct
gcagtggcccacgttgtcgtgaaggtcattgtagaagaccaaaatgataatgcgccggtg
tttgtcaaccttccctactacgccgttgttaaagtggacactgaggtgggccatgtcatt
cgctatgtcactgctgtagacagagacagtggcagaaacggggaagtgcattactacctc
aaggaacatcatgaacactttcaaattggacccttgggtgaaatttcactgaaaaagcaa
tttgagcttgacaccttaaataaagaatatcttgttacagtggttgcaaaagatggaggg
aacccggccttttcagcggaagttatcgttccgatcactgtcatgaataaagccatgcct
gtgtttgaaaaacctttctacagtgcagagattgcagagagcatccaggtgcacagccct
gtggtccacgtgcaggctaacagcccggaaggcctgaaagtgttctacagcatcacagac
ggagaccctttcagccagttcactattaacttcaatactggagttatcaatgtcatagct
cctctggactttgaggcccacccggcatataagctgagcatacgcgcaactgactccttg
acgggcgctcatgctgaagtatttgtggacatcatagtagacgacatcaatgataaccct
cctgtgtttgctcagcagtcttatgcggtgaccctgtctgaggcatctgtaattggaacg
tctgttgttcaagttagagccaccgattctgattcagaaccaaatagaggaatctcatac
cagatgtttgggaatcacagcaagagtcatgatcattttcatgtagacagcagcactggc
ctcatctcactactcagaaccctggattacgagcagtcccggcagcacacgatttttgtg
agggcagttgatggtggtatgcccacgctgagcagtgatgtgattgtcacggtggacgtt
accgacctcaatgataatccaccactctttgaacaacagatttatgaagccagaattagc
gagcacgcccctcatgggcatttcgtgacctgtgtaaaagcctatgatgcagacagttca
gacatagacaagttgcagtattccattctgtctggcaatgatcataaacattttgtcatt
gacagtgcaacagggattatcaccctctcaaacctgcaccggcacgccctgaagccattt
tacagtcttaacctgtcagtgtctgatggagtttttagaagttccacccaggttcatgta
actgtaattggaggcaatttgcacagtcctgctttccttcagaacgaatatgaagtggaa
ctagctgaaaacgctcccctacataccctggtgatggaggtgaaaactacggatggggat
tctggtatttatggtcacgttacttaccatattgtaaatgactttgccaaagacagattt
tacataaatgagagaggacagatatttactttggaaaaacttgatcgagaaaccccggcg
gagaaagtgatctcagtccgtttaatggctaaggatgctggaggaaaagttgctttctgc
accgtgaatgtcatccttacagatgacaatgacaatgcaccacaatttcgagcaaccaaa
tacgaagtgaatatcgggtccagtgctgctaaagggacttcagtcgttaaagttcttgca
agtgatgccgatgagggctccaatgccgacatcacctatgccattgaagcagactctgaa
agtgtaaaagagaatttggaaattaacaaactgtccggcgtaatcactacaaaggagagc
ctcattggcttggaaaatgaattcttcactttctttgttagagctgtggataatgggtct
ccatcaaaagaatctgttgttcttgtctatgttaaaatccttccaccggaaatgcagctt
ccaaaattttcagaacctttctatacctttacagtgtcagaggacgtgcctattggaaca
gagatagatctcatccgagcagaacatagtgggactgttctttacagcctggtcaaaggg
aatactccagaaagcaatagggatgagtcctttgtgattgacagacagagcgggagactg
aagttggagaagagtcttgatcatgagacaactaagtggtatcagttttccatactggcc
aggtgcactcaagatgaccatgagatggtggcttctgtagatgttagtatccaagtgaaa
gatgcaaatgacaacagcccggtctttgaatctagtccatatgaggcattcattgttgaa
aacctgccagggggaagtagagtaattcagatcagggcatctgatgctgactcaggaacc
aacggccaagttatgtatagcctggatcagtcacaaagtgtggaagtcattgaatccttt
gccattaacatggaaacaggctggattacaactttaaaggaacttgaccatgaaaagaga
gacaattaccagattaaagtggttgcatcagatcatggtgaaaagatccagctatcctcc
acagccattgtggatgttaccgtcaccgatgtcaacgatagtccaccacgattcacggcc
gagatctataaagggactgtgagtgaggatgacccccaaggtggggtgattgccatctta
agtaccacggatgctgattctgaagagatcaacagacaagttacatatttcataacagga
ggggatcctttaggacagtttgccgttgaaactatacagaatgaatggaaggtatatgtg
aagaaacctctagacagggaaaaaagggacaattaccttcttactatcacggcaactgat
ggcaccttctcatcaaaagcgatagttgaagtgaaagttctggatgcaaatgacaacagt
ccagtttgtgaaaagactttatattcagacactattcctgaagacgtccttcctggaaaa
ttgatcatgcagatctctgctacagacgcagacatccgctctaacgctgaaattacttac
acgttattgggttcaggtgcagaaaaattcaaactaaatccagacacaggtgaactgaaa
acgtcaaccccccttgatcgtgaggagcaagctgtttatcatcttctcgtcagggccaca
gatggaggaggaagattctgccaagccagtattgtgctcacgctagaagatgtgaacgat
aacgcccccgaattctctgccgatccttatgccatcaccgtgtttgaaaacacagagccg
ggaacgctgctgacaagagtgcaggccacagatgccgacgcaggattaaatcggaagatt
ttatactcactgattgactctgctgatgggcagttctccattaacgaattatctggaatt
attcagttagaaaaacctttggacagagaactccaggcagtatacaccctctctttgaaa
gctgtggatcaaggcttgccaaggaggctgactgccactggcactgtgattgtatcagtt
cttgacataaatgacaacccccctgtgtttgagtaccgtgaatatggtgccaccgtgtct
gaggacattcttgttggaactgaagttcttcaagtgtatgcagcaagtcgggatattgaa
gcaaatgcagaaatcacctactcaataataagtggaaatgaacatgggaaattcagcata
gattctaaaacaggggccgtatttatcattgagaatctggattatgagagctctcatgag
tattacctaacagtagaggccactgatggaggcacgccttcactgagcgacgttgccact
gtgaacgttaatgtaacagatatcaacgataatacccctgtgttcagccaagacacctac
acgacagtcatcagtgaagatgccgttcttgagcagtctgtcatcacggttatggccgat
gatgccgatggaccttccaacagccacatccactactcaattatagatggcaaccaagga
agctcgttcacaattgaccccgtcaggggagaagtcaaagtgaccaaacttctcgaccga
gaaacgatttcaggttacacgctcacggttcaagcttctgataatggcagtccacccaga
gtcaacacgacgaccgtgaacatcgatgtgtccgatgtcaatgacaacgcgcccgtcttc
tccaggggaaactacagtgtcattatccaggaaaataagccagtgggcttcagcgtgctg
cagctggtagtaacagatgaggattcttcccataacggtccacccttcttctttactatt
gtaactggaaatgatgagaaggcttttgaagttaacccgcaaggagtcctcctgacatca
tctgccatcaagaggaaggagaaagatcattacttactgcaggtgaaggtggcagataat
ggaaagcctcagttgtcatctttgacatacattgacattagggtaattgaggagagcatc
tatccgcctgcgattttgcccctggagattttcatcacctcttctggagaagaatactca
ggtggcgtcattgggaagatccatgccacagaccaggacgtgtatgatactctaacctac
agtctcgaccctcagatggacaacctgttctctgtttccagcacagggggcaagctgata
gcacacaaaaagctagacatagggcaataccttctcaatgtcagcgtaacagatgggaag
ttcacgacggtggccgacatcacagtgcatatcagacaagtcacacaggagatgttgaac
cacaccatcgcgatccgctttgccaacctcactccggaagaattcgttggtgactactgg
cgcaacttccagcgagctttacggaacatcctgggtgtgaggaggaacgacatacagatt
gttagtttgcagtcctctgaacctcacccacatctggacgtcttactttttgtagagaaa
ccaggtagtgctcagatctcaacaaaacaacttctgcacaagattaactcttccgtgact
gacattgaggaaatcattggagttaggatactgaatgtattccagaaactctgcgcggga
ctggactgcccctggaagttctgcgatgaaaaggtgtctgtggatgaaagtgtgatgtca
acacacagcacagccagactgagttttgtgactccccgccaccacagggcagcggtgtgt
ctctgcaaagagggaaggtgcccacctgtccaccatggctgtgaagatgatccgtgccct
gagggatccgaatgtgtgtctgatccctgggaggagaaacacacctgtgtctgtcccagc
ggcaggtttggtcagtgcccagggagttcatctatgacactgactggaaacagctacgtg
aaataccgtctgacggaaaatgaaaacaaattagagatgaaactgaccatgaggctcaga
acatattccacgcatgcggttgtcatgtatgctcgaggaactgactatagcatcttggag
attcatcatggaaggctgcagtacaagtttgactgtggaagtggccctggaattgtctct
gttcagagcattcaggtcaatgatgggcagtggcacgcagtggccctggaagtgaatgga
aactatgctcgcttggttctagaccaagttcatactgcatcgggcacagccccagggact
ctgaaaaccctgaacctggataactatgtgttttttggtggccacatccgtcagcaggga
acaaggcatggaagaagtcctcaagttggtaatggtttcaggggttgtatggactccatt
tatttgaatgggcaggagctccctttaaacagcaaacccagaagctatgcacacatcgaa
gagtcggtggatgtatctccaggctgcttcctgacggccacggaagactgcgccagcaac
ccttgccagaatggaggcgtttgcaatccgtcacctgctggaggttattactgcaaatgc
agtgccttgtacatagggacccactgtgagataagcgtcaatccgtgttcctccaagcca
tgcctctatgggggcacgtgtgttgtcgacaacggaggctttgtttgccagtgtagagga
ttatatactggtcagaggtgtcagcttagtccatactgcaaagatgaaccctgtaagaat
ggcggaacatgctttgacagtttggatggcgccgtttgtcagtgtgattcgggttttagg
ggagaaaggtgtcagagtgatatcgacgagtgctctggaaacccttgcctgcacggggcc
ctctgtgagaacacgcacggctcctatcactgcaactgcagccacgagtacaggggacgt
cactgcgaggatgctgcgcccaaccagtatgtgtccacgccgtggaacattgggttggcg
gaaggaattggaatcgttgtgtttgttgcagggatatttttactggtggtggtgtttgtt
ctctgccgtaagatgattagtcggaaaaagaagcatcaggctgaacctaaagacaagcac
ctgggacccgctacggctttcttgcaaagaccgtattttgattccaagctaaataagaac
atttactcagacataccaccccaggtgcctgtccggcctatttcctacaccccgagtatt
ccaagtgactcaagaaacaatctggaccgaaattccttcgaaggatctgctatcccagag
catcccgaattcagcacttttaaccccgagtctgtgcacgggcaccgaaaagcagtggcg
gtctgcagcgtggcgccaaacctgcctcccccacccccttcaaactccccttctgacagc
gactccatccagaagcctagctgggactttgactatgacacaaaagtggtggatcttgat
ccctgtctttccaagaagcctctagaggaaaagccttcccagccatacagtgcccgggaa
agcctgtctgaagtgcagtctctgagctccttccagtccgaatcgtgcgatgacaatggg
tatcactgggatacatcagattggatgccaagcgttcctctgccggacatacaagagttc
cccaactatgaggtgattgatgagcagacacccctgtactcagcagatccaaacgccatc
gatacggactattaccctggaggctacgacatcgaaagtgattttcctccacccccagaa
gacttccccgcagctgatgagctaccaccgttaccgcccgaattcagcaatcagtttgaa
tccatccaccctcctagagacatgcctgccgcgggtagcttgggttcttcatcaagaaac
cggcagaggttcaacttgaatcagtatttgcccaatttttatcccctcgatatgtctgaa
cctcaaacaaaaggcactggtgagaatagtacttgtagagaaccccatgccccttacccg
ccagggtatcaaagacacttcgaggcgcccgctgtcgagagcatgcccatgtctgtgtac
gcctccaccgcctcctgctctgacgtgtcagcctgctgcgaagtggagtccgaggtcatg
atgagtgactatgagagcggggacgacggccacttcgaagaggtgacgatcccgcccctg
gattcccagcagcacacggaagtctga

DBGET integrated database retrieval system