KEGG   Homo sapiens (human): 2197Help
Entry
2197              CDS       T01001                                 

Gene name
FAU, FAU1, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1
Definition
(RefSeq) FAU, ubiquitin like and ribosomal protein S30 fusion
  KO
K02983  small subunit ribosomal protein S30e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Module
hsa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    2197 (FAU)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    2197 (FAU)
  Archaea
    2197 (FAU)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   2197 (FAU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S30 ubiquitin Rad60-SLD Flavodoxin_NdrI TmoB
Motif
Other DBs
NCBI-GeneID: 2197
NCBI-ProteinID: NP_001988
OMIM: 134690
HGNC: 3597
Ensembl: ENSG00000149806
Vega: OTTHUMG00000165606
Pharos: P35544(Tbio)
UniProt: P35544
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 133 aa AA seqDB search
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVE
ALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacg
gtcgcccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtc
gtgctcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggag
gccctgactaccctggaagtagcaggccgcatgcttggaggtaaagtccatggttccctg
gcccgtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaag
aagaagacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtg
cccacctttggcaagaagaagggccccaatgccaactcttaa

DBGET integrated database retrieval system