KEGG   Homo sapiens (human): 2197Help
Entry
2197              CDS       T01001                                 

Gene name
FAU, FAU1, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1
Definition
Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Orthology
K02983  
small subunit ribosomal protein S30e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    2197 (FAU)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    2197 (FAU)
  Archaea
    2197 (FAU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 133 aa AA seqDB search
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVE
ALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacg
gtcgcccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtc
gtgctcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggag
gccctgactaccctggaagtagcaggccgcatgcttggaggtaaagtccatggttccctg
gcccgtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaag
aagaagacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtg
cccacctttggcaagaagaagggccccaatgccaactcttaa

DBGET integrated database retrieval system