KEGG   Homo sapiens (human): 219858Help
Entry
219858            CDS       T01001                                 

Gene name
OR8B12, OR11-317
Definition
olfactory receptor, family 8, subfamily B, member 12
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219858 (OR8B12)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219858 (OR8B12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24.2
AA seq 310 aa AA seqDB search
MAAKNSSVTEFILEGLTHQPGLRIPLFFLFLGFYTVTVVGNLGLITLIGLNSHLHTPMYF
FLFNLSLIDFCFSTTITPKMLMSFVSRKNIISFTGCMTQLFFFCFFVVSESFILSAMAYD
RYVAICNPLLYTVTMSCQVCLLLLLGAYGMGFAGAMAHTGSIMNLTFCADNLVNHFMCDI
LPLLELSCNSSYMNELVVFIVVAVDVGMPIVTVFISYALILSSILHNSSTEGRSKAFSTC
SSHIIVVSLFFGSGAFMYLKPLSILPLEQGKVSSLFYTIIVPVLNPLIYSLRNKDVKVAL
RRTLGRKIFS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaaaactcttctgtgacagagtttatcctcgaaggcttaacccaccagccg
ggactgcggatccccctcttcttcctgtttctgggtttctacacggtcaccgtggtgggg
aacctgggcttgataaccctgattgggctgaactctcacctgcacactcccatgtacttc
ttcctttttaacctctctttaatagatttctgtttctccactaccatcactcccaaaatg
ctgatgagttttgtctcaaggaagaacatcatttccttcacagggtgtatgactcagctc
ttcttcttctgcttctttgtcgtctctgagtccttcatcctgtcagcgatggcgtatgac
cgctacgtggccatctgtaacccactgttgtacacagtcaccatgtcttgccaggtgtgt
ttgctccttttgttgggtgcctatgggatggggtttgctggggccatggcccacacagga
agcataatgaacctgaccttctgtgctgacaaccttgtcaatcatttcatgtgtgacatc
cttcctctccttgagctctcctgcaacagctcttacatgaatgagctggtggtctttatt
gtggtggctgttgacgttggaatgcccattgtcactgtctttatttcttatgccctcatc
ctctccagcattctacacaacagttctacagaaggcaggtccaaagcctttagtacttgc
agttcccacataattgtagtttctcttttctttggttctggtgctttcatgtatctcaaa
cccctttccatcctgcccctcgagcaagggaaagtgtcctccctgttctataccataata
gtccccgtgttaaacccattaatctatagcttgaggaacaaggatgtcaaagttgccctg
aggagaactttgggcagaaaaatcttttcttaa

DBGET integrated database retrieval system