KEGG   Homo sapiens (human): 219865Help
Entry
219865            CDS       T01001                                 

Gene name
OR8G5, OR11-298, OR8G5P, OR8G6
Definition
olfactory receptor, family 8, subfamily G, member 5
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219865 (OR8G5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219865 (OR8G5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24.2
AA seq 346 aa AA seqDB search
MIIYKQGITFLQKENNNTIHLNTMFFLSPAETHQRMAAENHSFVTKFILVGLTEKSELQL
PLFLVFLGIYVVTVLGNLGMITLIGLSSHLHTPMYCFLSSLSFIDFCHSTVITPKMLVNF
VTEKNIISYPECMTQLYFFLVFAIAECHMLAAMAYDGYVAICSPLLYSIIISNKACFSLI
LVVYVIGLICASAHIGCMFRVQFCKFDVINHYFCDLISILKLSCSSTYINELLILIFSGI
NILVPSLTILSSYIFIIASILRIRYTEGRSKAFSTCSSHISAVSVFFGSAAFMYLQPSSV
SSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVHVALKKTLGKRTFL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatcatatataaacaagggatcactttcctacaaaaggagaataacaatacaattcac
ctaaataccatgttttttctctcccctgcagaaactcatcaaagaatggcagcagaaaac
cattcttttgtgactaagtttattctggttgggctaacagagaagtcagagctacagctg
cccctcttcctcgtcttcctgggaatctatgtagtcacagtgctggggaacctgggcatg
atcacactgattgggctcagttctcacctgcacacacctatgtactgtttcctcagcagt
ctgtccttcattgacttctgccattccactgtcattacccctaagatgctggtgaacttt
gtgacagagaagaacatcatctcctaccctgaatgcatgactcagctctacttcttcctc
gtttttgctattgcagagtgtcacatgttggctgcaatggcatatgacggctacgtggcc
atctgtagccccttgctgtacagcatcatcatatccaataaggcttgcttttctctgatt
ttagtggtgtatgtaataggcctgatttgtgcgtcagctcatataggctgtatgtttagg
gttcaattctgcaaatttgatgtgatcaaccattatttctgtgatcttatttctatcttg
aagctctcctgttctagtacttacattaatgagttactgattttaatctttagtggaatt
aacatccttgtccccagcctgaccatcctcagctcttacatcttcatcattgccagcatc
ctccgcattcgctacactgagggcaggtccaaagccttcagcacttgcagctcccacatc
tcggctgtttctgttttctttgggtctgcagcattcatgtacctgcagccatcatctgtc
agctccatggaccaggggaaagtgtcctctgtgttttatactattgttgtgcccatgctg
aaccccctgatctacagcctgaggaataaagatgtccacgttgccctgaagaaaacgcta
gggaaaagaacattcttatga

DBGET integrated database retrieval system