KEGG   Homo sapiens (human): 219869Help
Entry
219869            CDS       T01001                                 

Gene name
OR10G8, OR11-274, OR11-282
Definition
(RefSeq) olfactory receptor family 10 subfamily G member 8
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219869 (OR10G8)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219869 (OR10G8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219869
NCBI-ProteinID: NP_001004464
HGNC: 14845
Ensembl: ENSG00000234560
Vega: OTTHUMG00000165968
Pharos: Q8NGN5(Tdark)
UniProt: Q8NGN5 A0A126GVX3
Position
11q24.2
AA seq 311 aa AA seqDB search
MSNASLLTAFILMGLPHAPALDAPLFGVFLVVYVLTVLGNLLILLVIRVDSHLHTTMYYF
LTNLSFIDMWFSTVTVPKLLMTLVFPSGRAISFHSCMAQLYFFHFLGGTECFLYRVMSCD
RYLAISYPLRYTSMMTGRSCTLLATSTWLSGSLHSAVQAILTFHLPYCGPNWIQHYLCDA
PPILKLACADTSAIETVIFVTVGIVASGCFVLIVLSYVSIVCSILRIRTSEGKHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRKAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
LKDKVAHSQSK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgccagcctactgacagcgttcatcctcatgggccttccccatgccccagcg
ctggacgcccccctctttggagtcttcctggtggtttacgtgctcactgtgctggggaac
ctcctcatcctgctggtgatcagggtggattctcacctccacaccaccatgtactacttc
ctcaccaacctgtcgttcattgacatgtggttctccactgtcacggtgcccaaattgctg
atgactttggtgttcccaagtggcagggctatctccttccacagctgcatggctcagctc
tatttctttcacttcctagggggcaccgagtgtttcctctacagggtcatgtcctgtgat
cgctacctggccatcagttacccgctcaggtacaccagcatgatgactgggcgctcgtgt
actcttctggccaccagcacttggctcagtggctctctgcactctgctgtccaggccata
ttgactttccatttgccctactgtggacccaactggatccagcactatttgtgtgatgca
ccgcccatcctgaaactggcctgtgcagacacctcagccatagagactgtcatttttgtg
actgttggaatagtggcctcgggctgctttgtcctgatagtgctgtcctatgtgtccatc
gtctgttccatcctgcggatccgcacctcagaggggaagcacagagcctttcagacctgt
gcctcccactgtatcgtggtcctttgcttctttggccctggtcttttcatttacctgagg
ccaggctccaggaaagctgtggatggagttgtggccgttttctacactgtgctgacgccc
cttctcaaccctgttgtgtacaccctgaggaacaaggaggtgaagaaagctctgttgaag
ctgaaagacaaagtagcacattctcagagcaaatag

DBGET integrated database retrieval system