KEGG   Homo sapiens (human): 219873Help
Entry
219873            CDS       T01001                                 

Gene name
OR10S1, OR11-279
Definition
(RefSeq) olfactory receptor family 10 subfamily S member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219873 (OR10S1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219873 (OR10S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF2207
Motif
Other DBs
NCBI-GeneID: 219873
NCBI-ProteinID: NP_001004474
HGNC: 14807
Ensembl: ENSG00000196248
Vega: OTTHUMG00000165963
Pharos: Q8NGN2(Tdark)
UniProt: Q8NGN2
Position
11q24.1
AA seq 331 aa AA seqDB search
MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSLFFLLFLLIYSITVAGNLLILL
TVGSDSHLSLPMYHFLGHLSFLDACLSTVTVPKVMAGLLTLDGKVISFEGCAVQLYCFHF
LASTECFLYTVMAYDRYLAICQPLHYPVAMNRRMCAEMAGITWAIGATHAAIHTSLTFRL
LYCGPCHIAYFFCDIPPVLKLACTDTTINELVMLASIGIVAAGCLILIVISYIFIVAAVL
RIRTAQGRQRAFSPCTAQLTGVLLYYVPPVCIYLQPRSSEAGAGAPAVFYTIVTPMLNPF
IYTLRNKEVKHALQRLLCSSFRESTAGSPPP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactagccgctctgtgtgtgagaagatgaccatgacaacggagaaccccaaccagact
gtggtgagccacttcttcctggagggtttgaggtacaccgctaaacattctagcctcttc
ttcctcctcttcctcctcatctacagcatcactgtggctgggaatctcctcatcctccta
actgtgggctctgactctcacctcagcttacccatgtaccacttcctggggcacctctcc
ttcctggatgcctgtttgtctacagtgacagtgcccaaggtcatggcaggcctgctgact
ctggatgggaaggtgatctcctttgagggctgtgccgtacagctttattgcttccacttt
ctggccagcactgagtgcttcctgtacacagtcatggcctatgaccgctatctggctatc
tgtcaacccctgcactacccagtggccatgaacagaaggatgtgtgcagaaatggctgga
atcacctgggccataggtgccacgcacgctgcaatccacacctccctcaccttccgcctg
ctctactgtgggccttgccacattgcctacttcttctgcgacataccccctgtcctaaag
ctcgcctgtacagacaccaccattaatgagctagtcatgcttgccagcattggcatcgtg
gctgcaggctgcctcatcctcatcgttatttcctacatcttcatcgtggcagctgtgttg
cgcatccgcacagcccagggccggcagcgggccttctccccctgcactgcccagctcact
ggggtgctcctgtactacgtgccacctgtctgtatctacctgcagcctcgctccagtgag
gcaggagctggggcccctgctgtcttctacacaatcgtaactccaatgctcaacccattc
atttacactttgcggaacaaggaggtgaagcatgctctgcaaaggcttttgtgcagcagc
ttccgagagtctacagcaggcagcccacccccatag

DBGET integrated database retrieval system