KEGG   Homo sapiens (human): 219954Help
Entry
219954            CDS       T01001                                 

Gene name
OR9I1, OR11-228
Definition
olfactory receptor, family 9, subfamily I, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219954 (OR9I1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219954 (OR9I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 314 aa AA seqDB search
MAKNNLTRVTEFILMGFMDHPKLEIPLFLVFLSFYLVTLLGNVGMIMLIQVDVKLYTPMY
FFLSHLSLLDACYTSVITPQILATLATGKTVISYGHCAAQFFLFTICAGTECFLLAVMAY
DRYAAIRNPLLYTVAMNPRLCWSLVVGAYVCGVSGAILRTTCTFTLSFCKDNQINFFFCD
LPPLLKLACSDTANIEIVIIFFGNFVILANASVILISYLLIIKTILKVKSSGGRAKTFST
CASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVFYTVVIPMLNPLIYSLRNKDVKDA
FRKVARRLQVSLSM
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaataatctcaccagagtaaccgaattcattctcatgggctttatggaccac
cccaaattggagattcccctctttctggtgtttctgagtttctacctagtcacccttctt
gggaatgtggggatgattatgttaatccaagtagatgtcaaactctacaccccaatgtac
ttcttcctgagccacctctccctgctggatgcctgttacacctcagtcatcacccctcag
atcctagccacattggccacaggcaaaacggtcatctcctacggccactgtgctgcccag
ttctttttattcaccatctgtgcaggcacagagtgctttctgctggcagtgatggcctat
gatcgctatgctgccattcgcaacccactgctctataccgtggccatgaatcccaggctc
tgctggagcctggtggtaggagcctatgtctgtggggtgtcaggagccatcctgcgtacc
acttgcaccttcaccctctccttctgtaaggacaatcaaataaacttcttcttctgtgac
ctcccacccctgctgaagcttgcctgcagtgacacagcaaacatcgagattgtcatcatc
ttctttggcaattttgtgattttggccaatgcctccgtcatcctgatttcctatctgctc
atcatcaagaccattttgaaagtgaagtcttcaggtggcagggccaagactttctccaca
tgtgcctctcacatcactgctgtggcccttttctttggagcccttatcttcatgtatctg
caaagtggctcaggcaaatctctggaggaagacaaagtcgtgtctgtcttctatacagtg
gtcatccccatgctgaaccctctgatctacagcttaagaaacaaagatgtaaaagacgcc
ttcagaaaggtcgctaggagactccaggtgtccctgagcatgtag

DBGET integrated database retrieval system