KEGG   Homo sapiens (human): 219960Help
Entry
219960            CDS       T01001                                 

Gene name
OR10Q1, OR11-233
Definition
(RefSeq) olfactory receptor family 10 subfamily Q member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219960 (OR10Q1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219960 (OR10Q1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219960
NCBI-ProteinID: NP_001004471
HGNC: 15134
Ensembl: ENSG00000180475
Vega: OTTHUMG00000167542
Pharos: Q8NGQ4(Tdark)
UniProt: Q8NGQ4
Position
11q12.1
AA seq 319 aa AA seqDB search
MPVGKLVFNQSEPTEFVFRAFTTATEFQVLLFLLFLLLYLMILCGNTAIIWVVCTHSTLR
TPMYFFLSNLSFLELCYTTVVVPLMLSNILGAQKPISLAGCGAQMFFFVTLGSTDCFLLA
IMAYDRYVAICHPLHYTLIMTRELCTQMLGGALGLALFPSLQLTALIFTLPFCGHHQEIN
HFLCDVPPVLRLACADIRVHQAVLYVVSILVLTIPFLLICVSYVFITCAILSIRSAEGRR
RAFSTCSFHLTVVLLQYGCCSLVYLRPRSSTSEDEDSQIALVYTFVTPLLNPLLYSLRNK
DVKGALRSAIIRKAASDAN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtggggaaacttgtcttcaaccagtctgagcccactgagtttgtgttccgtgcg
ttcaccacagccactgaattccaggttcttctcttccttctcttcctcctcctctacttg
atgatcctctgtggcaacacagccatcatctgggtggtgtgcacacacagcaccctccgc
accccgatgtatttcttcctgtccaacctgtctttcctggaactctgctacaccaccgtg
gtagtacccttgatgctttccaacattttgggggcccagaagcccatttcgttggctgga
tgtggggcccaaatgttcttctttgtcaccctcggcagcacggactgtttcctcttggcg
atcatggcctatgaccgctatgtggctatctgccacccgctgcactacaccctcatcatg
acccgcgagctgtgcacgcagatgctgggtggggccctgggcctggccctcttcccctcc
ctgcagctcaccgccttaatcttcaccctgcccttttgcggccaccaccaggaaatcaac
cacttcctctgcgatgtgcctcccgtcctgcgcctggcctgcgctgacatccgcgtgcac
caggctgtcctctatgtcgtgagcatcctcgtgctgaccatccccttcctgctcatctgc
gtctcctacgtgttcatcacctgtgccatcctgagcatccgttctgccgagggccgccgc
cgggccttctccacctgctccttccacctcaccgtggtcctgctgcagtatggctgctgc
agcctcgtgtacctgcgtcctcggtccagcacctcagaggatgaggacagccaaatcgcg
ttggtctacacctttgtcacccccttactcaaccctttgctttacagccttaggaacaag
gatgtcaaaggtgctctgaggagtgccattatccgtaaagcagcctctgacgccaactga

DBGET integrated database retrieval system