KEGG   Homo sapiens (human): 219965Help
Entry
219965            CDS       T01001                                 

Gene name
OR5B17, OR11-237, OR5B20P
Definition
(RefSeq) olfactory receptor family 5 subfamily B member 17
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219965 (OR5B17)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219965 (OR5B17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF3810
Motif
Other DBs
NCBI-GeneID: 219965
NCBI-ProteinID: NP_001005489
HGNC: 15267
Ensembl: ENSG00000197786
Vega: OTTHUMG00000167465
Pharos: Q8NGF7(Tdark)
UniProt: Q8NGF7 A0A126GVL8
Position
11q12.1
AA seq 314 aa AA seqDB search
MENNTEVSEFILLGLTNAPELQVPLFIMFTLIYLITLTGNLGMIILILLDSHLHTPMYFF
LSNLSLAGIGYSSAVTPKVLTGLLIEDKAISYSACAAQMFFCAVFATVENYLLSSMAYDR
YAAVCNPLHYTTTMTTRVCACLAIGCYVIGFLNASIQIGDTFRLSFCMSNVIHHFFCDKP
AVITLTCSEKHISELILVLISSFNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCG
SHLIAIFLFYITVIIMYIRPSSSHSMDTDKIASVFYTMIIPMLSPIVYTLRNKDVKNAFM
KVVEKAKYSLDSVF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagaataatacagaggtgagtgaattcatcctgcttggtctaaccaatgccccagaa
ctacaggttcccctctttatcatgtttaccctcatctacctcatcactctgactgggaac
ctggggatgatcatattaatcctgctggactctcatctccacactcccatgtactttttt
ctcagtaacctgtctcttgcaggcattggttactcctcagctgtcactccaaaggtttta
actgggttgcttatagaagacaaagccatctcctacagtgcctgtgctgctcagatgttc
ttttgtgcagtctttgccactgtggaaaattacctcttgtcctcaatggcctatgaccgc
tacgcagcagtgtgtaaccccctacattataccaccaccatgacaacacgtgtgtgtgct
tgtctggctataggctgttatgtcattggttttctgaatgcttctatccaaattggagat
acatttcgcctctctttctgcatgtccaatgtgattcatcactttttctgtgacaaacca
gcagtcattactctgacctgctctgagaaacacattagtgagttgattcttgttcttata
tcaagttttaatgtcttttttgcacttcttgttaccttgatttcctatctgttcatattg
atcaccattcttaagaggcacacaggtaagggataccagaagcctttatctacctgtggt
tctcacctcattgccattttcttattttatataactgtcatcatcatgtacatacgacca
agttccagtcattccatggacacagacaaaattgcatctgtgttctacactatgatcatc
cccatgctcagtcctatagtctataccctgaggaacaaagacgtgaagaatgcattcatg
aaggttgttgagaaggcaaaatattctctagattcagtcttttaa

DBGET integrated database retrieval system