KEGG   Homo sapiens (human): 219968Help
Entry
219968            CDS       T01001                                 

Gene name
OR5B21
Definition
(RefSeq) olfactory receptor family 5 subfamily B member 21
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219968 (OR5B21)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219968 (OR5B21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 219968
NCBI-ProteinID: NP_001005218
HGNC: 19616
Ensembl: ENSG00000198283
Vega: OTTHUMG00000167519
Pharos: A6NL26(Tdark)
UniProt: A6NL26
Position
11q12.1
AA seq 309 aa AA seqDB search
MENSTEVTEFILLGLTDDPNLQIPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFF
LSNLSLVDLGYSSAVAPKTVAALRSGDKAISYDGCAAQFFFFVGFATVECYLLASMAYDR
HAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAGTFRLSFCGSNEINHFFCDIP
PLLALSCSDTRISKLVVFVAGFNVFFTLLVILISYFFICITIQRMHSAEGQKKVFSTCAS
HLTALSIFYGTIIFMYLQPNSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK
ILNKLYPQY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagcacagaagtgacagagtttatcctcttgggattaacagatgaccccaat
cttcagatacccctcctcctggcatttttattcatctacctcatcaccctgcttgggaat
gggggaatgatggtgatcatccactcagactcccatctccacactccaatgtactttttc
ctcagtaacctctcccttgtagacttgggttactcatcagctgtagcccccaaaacggtg
gctgcattgcggtcaggggacaaggccatctcctacgatggatgtgcagctcagttcttc
ttctttgtggggtttgccactgttgagtgctacctcctggcctccatggcctatgatcgc
catgcagcggtatgtaggcctcttcattacaccaccaccatgacagcaggtgtgtgtgcc
ctccttgctactggttcctatgtctctggcttcctcaatgcctctatccatgcagcaggc
accttcagactctccttctgtggttctaatgagattaatcatttcttctgtgacattccc
ccactcctggctctctcatgctctgacacacgcatcagcaagttggtggtctttgtggca
ggcttcaacgtctttttcaccctcctggtcatccttatttcttacttcttcatatgcatc
accattcagaggatgcattctgctgaagggcagaagaaagtcttctccacctgtgcttcc
catctcactgctttgtccatcttctatggcacaatcatcttcatgtacttacagcccaac
tccagccagtccgtggacacagacaaaatagcctctgtgttttacacagtggtgattccc
atgctgaatcccttgatatacagccttaggaacaaagaagtgaaaagtgctctctggaaa
atactcaacaaactttacccccaatattaa

DBGET integrated database retrieval system