KEGG   Homo sapiens (human): 219981Help
Entry
219981            CDS       T01001                                 

Gene name
OR5A2
Definition
(RefSeq) olfactory receptor family 5 subfamily A member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219981 (OR5A2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219981 (OR5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219981
NCBI-ProteinID: NP_001001954
HGNC: 15249
Ensembl: ENSG00000172324
Vega: OTTHUMG00000167419
Pharos: Q8NGI9(Tdark)
UniProt: Q8NGI9 A0A126GVD5
Position
11q12.1
AA seq 324 aa AA seqDB search
MAVGRNNTIVTKFILLGLSDHPQMKIFLFMLFLGLYLLTLAWNLSLIALIKMDSHLHMPM
YFFLSNLSFLDICYVSSTAPKMLSDIITEQKTISFVGCATQYFVFCGMGLTECFLLAAMA
YDRYAAICNPLLYTVLISHTLCLKMVVGAYVGGFLSSFIETYSVYQHDFCGPYMINHFFC
DLPPVLALSCSDTFTSEVVTFIVSVVVGIVSVLVVLISYGYIVAAVVKISSATGRTKAFS
TCASHLTAVTLFYGSGFFMYMRPSSSYSLNRDKVVSIFYALVIPVVNPIIYSFRNKEIKN
AMRKAMERDPGISHGGPFIFMTLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaggaaggaacaacacaattgtgacaaaattcattctcctgggactttcagac
catcctcaaatgaagattttccttttcatgttatttctggggctctacctcctgacgttg
gcctggaacttaagcctcattgccctcattaagatggactctcacctgcacatgcccatg
tacttcttcctcagtaacctgtccttcctggacatctgctatgtgtcctccaccgcccct
aagatgctgtctgacatcatcacagagcagaaaaccatttcctttgttggctgtgccact
cagtactttgtcttctgtgggatggggctgactgaatgctttctcctggcagctatggcc
tatgaccggtatgctgcaatctgcaaccccttgctttacacagtcctcatatcccataca
ctttgtttaaagatggtggttggcgcctatgtgggtggattccttagttctttcattgaa
acatactctgtctatcagcatgatttctgtgggccctatatgatcaaccactttttctgt
gacctccctccagtcctggctctgtcctgctctgataccttcaccagcgaggtggtgacc
ttcatagtcagtgttgtcgttggaatagtgtctgtgctagtggtcctcatctcttatggt
tacattgttgctgctgttgtgaagatcagctcagctacaggtaggacaaaggccttcagc
acttgtgcctctcacctgactgctgtgaccctcttctatggttctggattcttcatgtac
atgcgacccagttccagctactccctaaacagggacaaggtggtgtccatattctatgcc
ttggtgatccccgtggtgaatcccatcatctacagttttaggaataaggagattaaaaat
gccatgaggaaagccatggaaagggaccccgggatttctcacggtggaccattcattttt
atgaccttgggctaa

DBGET integrated database retrieval system