KEGG   Homo sapiens (human): 219982Help
Entry
219982            CDS       T01001                                 

Gene name
OR5A1, OR11-249, OR5A1P, OST181
Definition
olfactory receptor, family 5, subfamily A, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 315 aa AA seqDB search
MSITKAWNSSSVTMFILLGFTDHPELQALLFVTFLGIYLTTLAWNLALIFLIRGDTHLHT
PMYFFLSNLSFIDICYSSAVAPNMLTDFFWEQKTISFVGCAAQFFFFVGMGLSECLLLTA
MAYDRYAAISSPLLYPTIMTQGLCTRMVVGAYVGGFLSSLIQASSIFRLHFCGPNIINHF
FCDLPPVLALSCSDTFLSQVVNFLVVVTVGGTSFLQLLISYGYIVSAVLKIPSAEGRWKA
CNTCASHLMVVTLLFGTALFVYLRPSSSYLLGRDKVVSVFYSLVIPMLNPLIYSLRNKEI
KDALWKVLERKKVFS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccataaccaaagcctggaacagctcatcagtgaccatgttcatcctcctgggattc
acagaccatccagaactccaggccctcctctttgtgaccttcctgggcatctatcttacc
accctggcctggaacctggccctcatttttctgatcagaggtgacacccatctgcacaca
cccatgtacttcttcctaagcaacttatctttcattgacatctgctactcttctgctgtg
gctcccaatatgctcactgacttcttctgggagcagaagaccatatcatttgtgggctgt
gctgctcagttttttttctttgtcggcatgggtctgtctgagtgcctcctcctgactgct
atggcatacgaccgatatgcagccatctccagcccccttctctaccccactatcatgacc
cagggcctctgtacacgcatggtggttggggcatatgttggtggcttcctgagctccctg
atccaggccagctccatatttaggcttcacttttgcggacccaacatcatcaaccacttc
ttctgcgacctcccaccagtcctggctctgtcttgctctgacaccttcctcagtcaagtg
gtgaatttcctcgtggtggtcactgtcggaggaacatcgttcctccaactccttatctcc
tatggttacatagtgtctgcggtcctgaagatcccttcagcagagggccgatggaaagcc
tgcaacacgtgtgcctcgcatctgatggtggtgactctgctgtttgggacagcccttttc
gtgtacttgcgacccagctccagctacttgctaggcagggacaaggtggtgtctgttttc
tattcattggtgatccccatgctgaaccctctcatttacagtttgaggaacaaagagatc
aaggatgccctgtggaaggtgttggaaaggaagaaagtgttttcttag

DBGET integrated database retrieval system