KEGG   Homo sapiens (human): 219986Help
Entry
219986            CDS       T01001                                 

Gene name
OR4D11, OR4D11P
Definition
olfactory receptor, family 4, subfamily D, member 11
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219986 (OR4D11)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219986 (OR4D11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 311 aa AA seqDB search
MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY
FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF
DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR
LKRRLVPSERE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagttgggaaatgtcaccagagtaaaagaatttatatttctgggacttactcaatcc
caagaccagagtttggtcttgtttctttttttatgtcttgtgtacatgacgactctgctg
ggaaacctcctcatcatggtcaccgtgacctgtgagtctcgccttcacacccccatgtac
ttcctgctccgcaatctagccatccttgacatctgcttctcctccacaactgctcctaaa
gtcttgctggaccttctgtcaaagaaaaagaccatatcctatacaagctgcatgacacag
atatttctcttccacctccttggtggggcagacattttttctctctctgtgatggcgttt
gactgctacatggccatctccaagcccctgcactatgtgaccatcatgagtagagggcaa
tgcactgccctcatctctgcctcttggatggggggctttgtccactccatcgtgcagatc
tccctgttgctgcctctccctttctgtggacccaatgttcttgacactttctactgcgat
gtcccccaggtcctcaaactcacttgcactgacacttttgctcttgagttcttgatgatt
tccaacaatggcctggtcactaccctgtggtttatcttcctgcttgtgtcctacacagtc
atcctaatgacgctgaggtctcaggcaggagggggcaggaggaaagccatctccacttgc
acctcccacatcactgtggtgaccctgcattttgtgccctgcatctatgtctatgcccgg
cccttcactgccctccccacagaaaaggccatctctgtcaccttcactgtcatctcccct
ctgctgaaccctttgatctacactctgaggaaccaggaaatgaagtcagccatgagaaga
ctgaagagaagactcgtgccttctgaaagggaatag

DBGET integrated database retrieval system