KEGG   Homo sapiens (human): 22Help
Entry
22                CDS       T01001                                 

Gene name
ABCB7, ABC7, ASAT, Atm1p, EST140535
Definition
ATP-binding cassette, sub-family B (MDR/TAP), member 7
Orthology
K05662  
ATP-binding cassette, subfamily B (MDR/TAP), member 7
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Disease
H00982  
Sideroblastic anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    22 (ABCB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq13.3
AA seq 752 aa AA seqDB search
MALLAMHSWRWAAAAAAFEKRRHSAILIRPLVSVSGSGPQWRPHQLGALGTARAYQIPES
LKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKI
IKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSD
APNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGF
HLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGT
LGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFL
KTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLASQGIVAGTLTVGDLVMVNGLLFQL
SLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNVHFE
YIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVS
LESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDT
QVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTS
IFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKW
EAKKENISKEEERKKLQEEIVNSVKGCGNCSC
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctcgcgatgcattcttggcgctgggcggccgcggcggctgctttcgaaaag
cgccggcactccgcgattctgatccggcctttagtctctgttagcggctcaggtccgcag
tggaggccacatcaactcggcgccttgggaaccgctcgagcctaccagattccagagtca
ttaaaaagtatcacatggcagagattgggaaaaggcaattcaggacagttcttagatgct
gcaaaggctctccaggtatggccactgatagaaaagaggacatgttggcatggtcatgca
ggaggaggactccacacagacccaaaagaagggttaaaagatgttgatactcggaaaatc
ataaaagcaatgctttcttatgtgtggcccaaagacaggccagatctacgagctagagtt
gccatttcgctgggatttttgggtggtgcaaaggccatgaatattgtggttcccttcatg
tttaaatatgctgtagacagcctcaaccagatgtcgggaaacatgctgaacctgagtgat
gcaccaaatacagttgcaaccatggcaacagcagttctgattggctatggtgtatcaaga
gctggagctgctttttttaacgaagttcgaaatgcagtatttggcaaggtagcccagaat
tcaatccgaagaatagccaaaaatgtctttctccatcttcacaacctggatctgggtttt
cacctgagcagacagacgggagctttatctaaggctattgacagaggaacaaggggtatc
agttttgtcctgagtgctttggtatttaatcttcttcccatcatgtttgaagtgatgctt
gtcagtggtgttttgtattacaaatgcggtgcccagtttgctttggtaacccttggaaca
cttggtacatacacagcattcacagttgcagtcacacggtggagaactagatttagaata
gaaatgaacaaagcagataatgatgcaggtaatgctgctatagactcactgctgaattat
gaaactgtgaagtattttaataatgaaagatatgaagcacagagatatgatggatttttg
aagacgtatgagactgcttcattgaaaagtacctctactctggctatgctgaactttggt
caaagtgctattttcagtgtcggtttaacagctataatggtgctcgccagtcagggaatt
gtggcaggtacccttactgttggagatctagtaatggtgaatggactgctttttcagctt
tcattacccctgaactttctgggaactgtatatagagagactagacaagcactcatagat
atgaacaccttgtttactctactcaaggtagacacccaaattaaagacaaagtgatggca
tctccccttcagatcacaccacagacagctaccgtggcctttgataatgtgcattttgaa
tacattgagggccagaaagtccttagtggaatatcctttgaagtccctgcaggaaagaaa
gtggccattgtaggaggtagtgggtcagggaaaagcacaatagtgaggctattatttcgc
ttctatgagcctcaaaagggtagcatttatcttgctggtcaaaatatacaagatgtgagc
ctggaaagccttcggagggcagtgggagtggtacctcaggatgctgtcctcttccataat
actatttattacaacctcttatatggaaacatcagtgcttcacctgaggaagtgtatgca
gtggcaaaattagctggacttcatgatgcaattcttcgaatgccacatggatatgacacc
caagtaggggaacgaggactcaagctttcaggaggagaaaagcaaagagtagcaattgca
agagccattttgaaggaccccccagtcatactctatgatgaagctacttcatcgttagat
tcgattactgaagagactattcttggtgccatgaaggatgtggtcaaacacagaacttct
attttcattgcacacagattgtcaacagtggttgatgcagatgaaatcattgtcttggat
cagggtaaggtagccgaacgtggtacccaccatggtttgcttgctaaccctcatagtatc
tattcagaaatgtggcatacacagagcagccgtgtgcagaaccatgataaccccaaatgg
gaagcaaagaaagaaaatatatccaaagaggaggaaagaaagaaactacaagaagaaatt
gtcaatagtgtgaaaggctgtggaaactgttcgtgctaa

DBGET integrated database retrieval system