KEGG   Homo sapiens (human): 220Help
Entry
220               CDS       T01001                                 

Gene name
ALDH1A3, ALDH1A6, ALDH6, MCOP8, RALDH3
Definition
aldehyde dehydrogenase 1 family, member A3 (EC:1.2.1.5)
Orthology
K00129  
aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Disease
H01027  
Anophthalmia and microphthalmia (A/M)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    220 (ALDH1A3)
  Amino acid metabolism
   00340 Histidine metabolism
    220 (ALDH1A3)
   00350 Tyrosine metabolism
    220 (ALDH1A3)
   00360 Phenylalanine metabolism
    220 (ALDH1A3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    220 (ALDH1A3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    220 (ALDH1A3)
   00982 Drug metabolism - cytochrome P450
    220 (ALDH1A3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    220 (ALDH1A3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     220 (ALDH1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 512 aa AA seqDB search
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctaacggggccgtggaaaacgggcagccggacaggaagccgccggccctg
ccgcgccccatccgcaacctggaggtcaagttcaccaagatatttatcaacaatgaatgg
cacgaatccaagagtgggaaaaagtttgctacatgtaacccttcaactcgggagcaaata
tgtgaagtggaagaaggagataagcccgacgtggacaaggctgtggaggctgcacaggtt
gccttccagaggggctcgccatggcgccggctggatgccctgagtcgtgggcggctgctg
caccagctggctgacctggtggagagggaccgcgccaccttggccgccctggagacgatg
gatacagggaagccatttcttcatgcttttttcatcgacctggagggctgtattagaacc
ctcagatactttgcagggtgggcagacaaaatccagggcaagaccatccccacagatgac
aacgtcgtgtgcttcaccaggcatgagcccattggtgtctgtggggccatcactccatgg
aacttccccctgctgatgctggtgtggaagctggcacccgccctctgctgtgggaacacc
atggtcctgaagcctgcggagcagacacctctcaccgccctttatctcggctctctgatc
aaagaggccgggttccctccaggagtggtgaacattgtgccaggattcgggcccacagtg
ggagcagcaatttcttctcaccctcagatcaacaagatcgccttcaccggctccacagag
gttggaaaactggttaaagaagctgcgtcccggagcaatctgaagcgggtgacgctggag
ctgggggggaagaacccctgcatcgtgtgtgcggacgctgacttggacttggcagtggag
tgtgcccatcagggagtgttcttcaaccaaggccagtgttgcacggcagcctccagggtg
ttcgtggaggagcaggtctactctgagtttgtcaggcggagcgtggagtatgccaagaaa
cggcccgtgggagaccccttcgatgtcaaaacagaacaggggcctcagattgatcaaaag
cagttcgacaaaatcttagagctgatcgagagtgggaagaaggaaggggccaagctggaa
tgcgggggctcagccatggaagacaaggggctcttcatcaaacccactgtcttctcagaa
gtcacagacaacatgcggattgccaaagaggagattttcgggccagtgcaaccaatactg
aagttcaaaagtatcgaagaagtgataaaaagagcgaatagcaccgactatggactcaca
gcagccgtgttcacaaaaaatctcgacaaagccctgaagttggcttctgccttagagtct
ggaacggtctggatcaactgctacaacgccctctatgcacaggctccatttggtggcttt
aaaatgtcaggaaatggcagagaactaggtgaatacgctttggccgaatacacagaagtg
aaaactgtcaccatcaaacttggcgacaagaacccctga

DBGET integrated database retrieval system