KEGG   Homo sapiens (human): 220Help
Entry
220               CDS       T01001                                 

Gene name
ALDH1A3, ALDH1A6, ALDH6, MCOP8, RALDH3
Definition
aldehyde dehydrogenase 1 family, member A3 (EC:1.2.1.5)
Orthology
K00129  
aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hsa00360]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 512 aa AA seqDB search
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctaacggggccgtggaaaacgggcagccggacaggaagccgccggccctg
ccgcgccccatccgcaacctggaggtcaagttcaccaagatatttatcaacaatgaatgg
cacgaatccaagagtgggaaaaagtttgctacatgtaacccttcaactcgggagcaaata
tgtgaagtggaagaaggagataagcccgacgtggacaaggctgtggaggctgcacaggtt
gccttccagaggggctcgccatggcgccggctggatgccctgagtcgtgggcggctgctg
caccagctggctgacctggtggagagggaccgcgccaccttggccgccctggagacgatg
gatacagggaagccatttcttcatgcttttttcatcgacctggagggctgtattagaacc
ctcagatactttgcagggtgggcagacaaaatccagggcaagaccatccccacagatgac
aacgtcgtgtgcttcaccaggcatgagcccattggtgtctgtggggccatcactccatgg
aacttccccctgctgatgctggtgtggaagctggcacccgccctctgctgtgggaacacc
atggtcctgaagcctgcggagcagacacctctcaccgccctttatctcggctctctgatc
aaagaggccgggttccctccaggagtggtgaacattgtgccaggattcgggcccacagtg
ggagcagcaatttcttctcaccctcagatcaacaagatcgccttcaccggctccacagag
gttggaaaactggttaaagaagctgcgtcccggagcaatctgaagcgggtgacgctggag
ctgggggggaagaacccctgcatcgtgtgtgcggacgctgacttggacttggcagtggag
tgtgcccatcagggagtgttcttcaaccaaggccagtgttgcacggcagcctccagggtg
ttcgtggaggagcaggtctactctgagtttgtcaggcggagcgtggagtatgccaagaaa
cggcccgtgggagaccccttcgatgtcaaaacagaacaggggcctcagattgatcaaaag
cagttcgacaaaatcttagagctgatcgagagtgggaagaaggaaggggccaagctggaa
tgcgggggctcagccatggaagacaaggggctcttcatcaaacccactgtcttctcagaa
gtcacagacaacatgcggattgccaaagaggagattttcgggccagtgcaaccaatactg
aagttcaaaagtatcgaagaagtgataaaaagagcgaatagcaccgactatggactcaca
gcagccgtgttcacaaaaaatctcgacaaagccctgaagttggcttctgccttagagtct
ggaacggtctggatcaactgctacaacgccctctatgcacaggctccatttggtggcttt
aaaatgtcaggaaatggcagagaactaggtgaatacgctttggccgaatacacagaagtg
aaaactgtcaccatcaaacttggcgacaagaacccctga

DBGET integrated database retrieval system