KEGG   Homo sapiens (human): 2205Help
Entry
2205              CDS       T01001                                 

Gene name
FCER1A, FCE1A, FcERI
Definition
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Orthology
K08089  
Fc receptor, IgE, high affinity I, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Fc epsilon RI signaling pathway
Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    2205 (FCER1A)
 Human Diseases
  Immune diseases
   05310 Asthma
    2205 (FCER1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 257 aa AA seqDB search
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTR
KGFRLLNPHPKPNPKNN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgccatggaatcccctactctactgtgtgtagccttactgttcttcgctcca
gatggcgtgttagcagtccctcagaaacctaaggtctccttgaaccctccatggaataga
atatttaaaggagagaatgtgactcttacatgtaatgggaacaatttctttgaagtcagt
tccaccaaatggttccacaatggcagcctttcagaagagacaaattcaagtttgaatatt
gtgaatgccaaatttgaagacagtggagaatacaaatgtcagcaccaacaagttaatgag
agtgaacctgtgtacctggaagtcttcagtgactggctgctccttcaggcctctgctgag
gtggtgatggagggccagcccctcttcctcaggtgccatggttggaggaactgggatgtg
tacaaggtgatctattataaggatggtgaagctctcaagtactggtatgagaaccacaac
atctccattacaaatgccacagttgaagacagtggaacctactactgtacgggcaaagtg
tggcagctggactatgagtctgagcccctcaacattactgtaataaaagctccgcgtgag
aagtactggctacaattttttatcccattgttggtggtgattctgtttgctgtggacaca
ggattatttatctcaactcagcagcaggtcacatttctcttgaagattaagagaaccagg
aaaggcttcagacttctgaacccacatcctaagccaaaccccaaaaacaactga

DBGET integrated database retrieval system