KEGG   Homo sapiens (human): 2205Help
Entry
2205              CDS       T01001                                 

Gene name
FCER1A, FCE1A, FcERI
Definition
(RefSeq) Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
  KO
K08089  
Fc receptor, IgE, high affinity I, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid signaling pathway
Fc epsilon RI signaling pathway
Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    2205 (FCER1A)
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    2205 (FCER1A)
 Human Diseases
  Immune diseases
   05310 Asthma
    2205 (FCER1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 257 aa AA seqDB search
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTR
KGFRLLNPHPKPNPKNN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgccatggaatcccctactctactgtgtgtagccttactgttcttcgctcca
gatggcgtgttagcagtccctcagaaacctaaggtctccttgaaccctccatggaataga
atatttaaaggagagaatgtgactcttacatgtaatgggaacaatttctttgaagtcagt
tccaccaaatggttccacaatggcagcctttcagaagagacaaattcaagtttgaatatt
gtgaatgccaaatttgaagacagtggagaatacaaatgtcagcaccaacaagttaatgag
agtgaacctgtgtacctggaagtcttcagtgactggctgctccttcaggcctctgctgag
gtggtgatggagggccagcccctcttcctcaggtgccatggttggaggaactgggatgtg
tacaaggtgatctattataaggatggtgaagctctcaagtactggtatgagaaccacaac
atctccattacaaatgccacagttgaagacagtggaacctactactgtacgggcaaagtg
tggcagctggactatgagtctgagcccctcaacattactgtaataaaagctccgcgtgag
aagtactggctacaattttttatcccattgttggtggtgattctgtttgctgtggacaca
ggattatttatctcaactcagcagcaggtcacatttctcttgaagattaagagaaccagg
aaaggcttcagacttctgaacccacatcctaagccaaaccccaaaaacaactga

DBGET integrated database retrieval system