KEGG   Homo sapiens (human): 2206Help
Entry
2206              CDS       T01001                                 

Gene name
MS4A2, APY, ATOPY, FCER1B, FCERI, IGEL, IGER, IGHER, MS4A1
Definition
(RefSeq) membrane spanning 4-domains A2
  KO
K08090  
membrane-spanning 4-domains, subfamily A, member 2
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Fc epsilon RI signaling pathway
Asthma
Disease
H00079  
Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    2206 (MS4A2)
   04071 Sphingolipid signaling pathway
    2206 (MS4A2)
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    2206 (MS4A2)
 Human Diseases
  Immune diseases
   05310 Asthma
    2206 (MS4A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q01362(Tbio)
UniProt: 
Position
11q12.1
AA seq 244 aa AA seqDB search
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEF
LGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISER
RNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTE
IVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSP
PIDL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggacacagaaagtaataggagagcaaatcttgctctcccacaggagccttccagtgtg
cctgcatttgaagtcttggaaatatctccccaggaagtatcttcaggcagactattgaag
tcggcctcatccccaccactgcatacatggctgacagttttgaaaaaagagcaggagttc
ctgggggtaacacaaattctgactgctatgatatgcctttgttttggaacagttgtctgc
tctgtacttgatatttcacacattgagggagacattttttcatcatttaaagcaggttat
ccattctggggagccatatttttttctatttctggaatgttgtcaattatatctgaaagg
agaaatgcaacatatctggtgagaggaagcctgggagcaaacactgccagcagcatagct
gggggaacgggaattaccatcctgatcatcaacctgaagaagagcttggcctatatccac
atccacagttgccagaaattttttgagaccaagtgctttatggcttccttttccactgaa
attgtagtgatgatgctgtttctcaccattctgggacttggtagtgctgtgtcactcaca
atctgtggagctggggaagaactcaaaggaaacaaggttccagaggatcgtgtttatgaa
gaattaaacatatattcagctacttacagtgagttggaagacccaggggaaatgtctcct
cccattgatttataa

DBGET integrated database retrieval system