KEGG   Homo sapiens (human): 2207Help
Entry
2207              CDS       T01001                                 

Gene name
FCER1G, FCRG
Definition
Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Orthology
K07983  
Fc receptor, IgE, high affinity I, gamma polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Platelet activation
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Tuberculosis
Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04611 Platelet activation
    2207 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    2207 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    2207 (FCER1G)
 Human Diseases
  Immune diseases
   05310 Asthma
    2207 (FCER1G)
  Infectious diseases
   05152 Tuberculosis
    2207 (FCER1G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   2207 (FCER1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23
AA seq 86 aa AA seqDB search
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgattccagcagtggtcttgctcttactccttttggttgaacaagcagcggccctggga
gagcctcagctctgctatatcctggatgccatcctgtttctgtatggaattgtcctcacc
ctcctctactgtcgactgaagatccaagtgcgaaaggcagctataaccagctatgagaaa
tcagatggtgtttacacgggcctgagcaccaggaaccaggagacttacgagactctgaag
catgagaaaccaccacagtag

DBGET integrated database retrieval system