KEGG   Homo sapiens (human): 220988Help
Entry
220988            CDS       T01001                                 

Gene name
HNRNPA3, 2610510D13Rik, D10S102, FBRNP, HNRPA3
Definition
heterogeneous nuclear ribonucleoprotein A3
Orthology
K12741  
heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    220988 (HNRNPA3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    220988 (HNRNPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.2
AA seq 378 aa AA seqDB search
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaggtaaaaccgccgcccggtcgcccccagcccgactccggccgtcgccgtcgccgc
cggggggaggagggccatgatccaaaggaaccagagcagttgagaaaactgtttattggt
ggtctgagctttgaaactacagatgatagtttacgagaacattttgagaaatggggcaca
ctcacagattgtgtggtaatgagagacccccaaacaaaacgttccaggggctttggtttt
gtgacttattcttgtgttgaagaggtggatgcagcaatgtgtgctcgaccacacaaggtt
gatgggcgtgtagtggaaccaaagagagctgtttctagagaggattctgtaaagcctggt
gcccatctaacagtgaagaaaatttttgttggtggtattaaagaagatacagaagaatat
aatttgagagactactttgaaaagtatggcaagattgaaaccatagaagttatggaagac
aggcagagtggaaaaaagagaggatttgcttttgtaacttttgatgatcatgatacagtt
gataaaattgttgttcagaaataccacactattaatgggcataattgtgaagtgaaaaag
gccctttctaaacaagagatgcagtctgctggatcacagagaggtcgtggaggtggatct
ggcaattttatgggtcgcggagggaactttggaggtggtggaggtaattttggccgtggt
ggaaactttggtggaagaggaggctatggtggtggaggtggtggcagcagaggtagttat
ggaggaggtgatggtggatataatggatttggaggtgatggtggcaactatggcggtggt
cctggttatagtagtagagggggctatggtggtggtggaccaggatatggaaaccaaggt
ggtggatatggtggaggtggaggatatgatggttacaatgaaggaggaaattttggcggt
ggtaactatggtggtggtgggaactataatgattttggaaattatagtggacaacagcaa
tcaaattatggacccatgaaagggggcagttttggtggaagaagctcgggcagtccctat
ggtggtggttatggatctggtggtggaagtggtggatatggtagcagaaggttctaa

DBGET integrated database retrieval system