KEGG   Homo sapiens (human): 221Help
Entry
221               CDS       T01001                                 

Gene name
ALDH3B1, ALDH4, ALDH7
Definition
(RefSeq) aldehyde dehydrogenase 3 family member B1
  KO
K00129  
aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    221 (ALDH3B1)
  Amino acid metabolism
   00340 Histidine metabolism
    221 (ALDH3B1)
   00350 Tyrosine metabolism
    221 (ALDH3B1)
   00360 Phenylalanine metabolism
    221 (ALDH3B1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    221 (ALDH3B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    221 (ALDH3B1)
   00982 Drug metabolism - cytochrome P450
    221 (ALDH3B1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    221 (ALDH3B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     221 (ALDH3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P43353(Tbio)
UniProt: 
Position
11q13.2
AA seq 468 aa AA seqDB search
MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC
GRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREK
PLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFD
TFSHHRACLLRSPGMEKLNALRYPPQSPRRLRMLLVAMEAQGCSCTLL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggacccccttggggacacgctgcggcgactgcgggaggccttccacgcggggcgcacg
cggccagctgagttccgggctgcgcagctccaaggcctgggccgcttcctgcaagaaaac
aagcagcttctgcacgacgcactggcccaggacctgcacaagtcagccttcgagtcggag
gtgtctgaggttgccatcagccagggcgaggtcaccctggccctcaggaacctccgggcc
tggatgaaggacgagcgtgtgcccaagaacctggccacgcagctggactccgccttcatc
cggaaggagccctttggcctggtcctcatcattgcgccctggaactatccgctgaacctg
acgctggtgcccctcgtgggagccctcgctgcagggaactgtgtggtgctgaagccatcg
gagattagcaagaacgtcgagaagatcctggccgaggtgctgccccaatacgtggaccag
agctgctttgctgtggtgctgggcgggccccaggagacggggcagctgctagagcacagg
ttcgactacatcttcttcacagggagccctcgtgtgggcaagattgttatgactgctgcc
gccaagcacctgacacctgtcaccctggagctggggggcaagaacccttgctacgtggac
gacaactgcgacccccagaccgtggccaaccgcgtggcctggttccgctacttcaacgcc
ggccagacctgcgtggcccccgactacgtcctatgcagccctgagatgcaggagaggctg
ctgcctgccctgcagagcaccatcacccgtttctatggcgacgacccccagagctcccca
aacctgggccgcatcatcaaccagaaacagttccagcggctgcgggcattgctgggctgc
ggccgtgtggccattgggggccagagcgatgagagcgatcgctacatcgcccccacggtg
ctggtggatgtgcaggagatggagcctgtgatgcaggaggagatcttcgggcccatcctg
cccatcgtgaacgtgcagagcttggacgaggccatcgagttcatcaaccggcgggagaag
cccctggccctgtacgccttctccaacagcagccaggtggtcaagcgggtgctgacccag
accagcagcgggggcttctgtgggaacgacggcttcatgcacatgaccctggccagcctg
ccttttggaggagtgggtgccagtgggatgggccggtaccatggcaagttctccttcgac
accttctcccaccatcgcgcctgcctcctgcgcagcccggggatggagaagctcaacgcc
ctccgctacccgccgcaatcgccgcgccgcctgaggatgctgctggtggccatggaggcc
caaggctgcagctgcacactgctctga

DBGET integrated database retrieval system