KEGG   Homo sapiens (human): 221037Help
Entry
221037            CDS       T01001                                 

Gene name
JMJD1C, KDM3C, TRIP-8, TRIP8
Definition
(RefSeq) jumonji domain containing 1C
  KO
K11449  
jumonji domain-containing protein 1C [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    221037 (JMJD1C)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     221037 (JMJD1C)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    221037 (JMJD1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15652(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q21.3
AA seq 2540 aa AA seqDB search
MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVE
FDDLEWDKREWVKVYEDFSTFLVEYHLIWAKRNDPSQTQGSKSKQIQWPALTFKPLVERN
IPSSVTAVEFLVDKQLDFLTEDSAFQPYQDDIDSLNPVLRDNPQLHEEVKVWVKEQKVQE
IFMQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQM
TFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNT
HQQQQQRSIRPNKRKGSDSSIPDEEKMKEEKYDYISRGENPKGKNKHLMNKRRKPEEDEK
KLNMKRLRTDNVSDFSESSDSENSNKRIIDNSSEQKPENELKNKNTSKINGEEGKPHNNE
KAGEETLKNSQPPWDQIQEDKKHEEAEKRKSVDTQLQEDMIIHSSEQSTVSDHNSNDLLP
QECNMDKTHTMELLPKEKFVSRPPTPKCVIDITNDTNLEKVAQENSSTFGLQTLQKMDPN
VSDSKHSIANAKFLETAKKDSDQSWVSDVVKVDLTQSSVTNASSGNDHLNMEKEKYVSYI
SPLSAVSVMEDKLHKRSPPPETIKSKLNTSVDTHKIKSSPSPEVVKPKITHSPDSVKSKA
TYVNSQATGERRLANKIEHELSRCSFHPIPTRSSTLETTKSPLIIDKNEHFTVYRDPALI
GSETGANHISPFLSQHPFPLHSSSHRTCLNPGTHHPALTPAPHLLAGSSSQTPLPTINTH
PLTSGPHHAVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQ
SPHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNS
PSPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPLKITAHSSPPLTKTLVDHHKEELER
KAFMEPLRSVASTSAKNDLDLNRSQTGKDCHLHRHFVDPVLNQLQRPPQETGERLNKYKE
EHRRILQESIDVAPFTTKIKGLEGERENYSRVASSSSSPKSHIIKQDMDVERSVSDLYKM
KHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYGDKQSNALAAAAANPQTLTSFI
TSLSKPPPLIKHQPESEGLVGKIPEHLPHQIASHSVTTFRNDCRSPTHLTVSSTNTLRSM
PALHRAPVFHPPIHHSLERKEGSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDS
QANFKSSSEQSLTEMWRPNNNLSKEKTEWHVEKSSGKLQAAMASVIVRPSSSTKTDSMPA
MQLASKDRVSERSSAGAHKTDCLKLAEAGETGRIILPNVNSDSVHTKSEKNFQAVSQGSV
PSSVMSAVNTMCNTKTDVITSAADTTSVSSWGGSEVISSLSNTILASTSSECVSSKSVSQ
PVAQKQECKVSTTAPVTLASSKTGSVVQPSSGFSGTTDFIHLKKHKAALAAAQYKSSNAS
ETEPNAIKNQTLSASLPLDSTVICSTINKANSVGNGQASQTSQPNYHTKLKKAWLTRHSE
EDKNTNKMENSGNSVSEIIKPCSVNLIASTSSDIQNSVDSKIIVDKYVKDDKVNRRKAKR
TYESGSESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEIEEDLKPNGVLSRSAKE
RSKLKLQSNSNTGIPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSK
KGEEPAHSPVFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENFEDDELDIE
TSKYILDIIGDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNIHWVC
QKCGFVVCLDCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMPTQIIPGSVLTDLLDAM
HTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPP
KSEKNGGSSPESDVGTDNKLTPPESQSPLHWLADLAEQKAREEKKENKELTLENQIKEER
EQDNSESPNGRTSPLVSQNNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGAPSSK
SGRTMPNILDDIIASVVENKIPPSKTSKINVKPELKEEPEESIISAVDENNKLYSDIPHS
WICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQA
DLLNCKDSIISNANVKEFWDGFEEVSKRQKNKSGETVVLKLKDWPSGEDFKTMMPARYED
LLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVS
DVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVD
KIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVL
PAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELRLLKEEINYDDKLQVKNILYHAV
KEMVRALKIHEDEVEDMEEN
NT seq 7623 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagagacgcgggcagagctggtgggtaagcggttcctgtgtgtggcggtcggc
gacgaggcacgttcggagcgctgggagagcggacgcggctggcgaagctggcgagcgggg
gtcatccgagccgtgtcacacagggacagccgcaatccggacctggcggtgtatgtggaa
tttgatgatcttgaatgggataaacgagagtgggttaaagtttatgaagatttttcaact
ttcttggtggaataccacttaatctgggccaaaaggaatgaccctagccagactcaggga
tcaaagagcaaacagattcagtggcctgcattgactttcaaacctctggttgaaagaaat
atacccagttcagtcactgcagtagaattccttgtagataagcaactggattttttaact
gaagatagtgcctttcagccctaccaggacgacatagacagcctaaacccagttctcagg
gacaacccgcagcttcatgaggaagtgaaagtctgggtaaaggaacaaaaggttcaggag
atttttatgcaaggtccttattccttaaatggatacagagtgagagtatatagacaagac
tctgccacccagtggtttactggcataattactcatcatgatctcttcacccgcaccatg
atcgttatgaatgatcaggtactagaaccacagaatgtcgatccttctatggttcaaatg
acctttctagatgatgttgttcactctttgttaaaaggtgaaaatattggcattacatca
cgacgcaggtctcgtgccaatcaaaacgtcaacgctgttcacagccattatacacgtgcc
caagcaaatagtcccagaccagcaatgaactcccaagctgctgtaccaaaacagaataca
caccagcaacagcaacaaagaagtatccgtccaaataagaggaagggctcagatagcagt
ataccagatgaagagaagatgaaggaggaaaaatatgattatatatcacgaggagaaaat
cctaaaggtaaaaacaaacacttgatgaataaaagaaggaaacctgaggaggatgaaaag
aaactaaatatgaaaagacttcgaactgacaatgtttcagacttttctgagagcagtgac
tcagaaaattcaaataagagaataatagataattcctcagaacagaagccagagaatgaa
ttgaaaaataaaaatacttcaaaaataaatggagaagaaggaaaaccccataataatgag
aaggcaggagaagagaccctaaaaaatagccagcctccctgggatcaaatacaggaagat
aaaaaacatgaagaagcagagaagcggaagtctgttgacactcagcttcaagaagatatg
attattcattcgtcagaacagtccacagtttctgatcataattctaatgatttacttcct
caggaatgcaatatggataaaacacataccatggaattgctaccaaaggagaagtttgta
tccagaccacccacaccaaaatgtgttattgatattacaaatgacactaatttagaaaag
gtggctcaggaaaactcaagtacctttggccttcagacacttcagaaaatggatcctaat
gttagtgattcaaaacactctattgcaaatgcaaaattcttggaaacagcaaaaaaagat
tctgaccagagctgggtcagtgatgtagttaaagtggatctaacccaatcaagtgttaca
aatgcttcttcaggaaatgatcacttgaacatggaaaaagagaagtatgtctcttacatt
tctcctttaagtgcagtttctgtcatggaagataagctgcataagcgaagtccacctcca
gagactataaaatctaaacttaatacttcagtagatactcacaagataaaatccagccca
tcacctgaagttgttaaacccaaaataactcattctcctgattctgtaaagtctaaggcc
acttatgtgaacagccaagctactggtgaaagaagattggcaaataagatagaacatgag
ctatcaagatgcagttttcatccaattcctactcgaagcagtacattagaaactacaaag
agtcctcttatcattgataaaaatgagcattttacagtttacagagatcctgcacttatt
gggtcagaaacaggagctaatcatatttcacctttcctaagccagcatccttttcctctt
cactcctcatctcatagaacctgtttaaatccaggtacccatcatcctgccttaactcct
gcaccccatttactagccggatcatctagtcaaactccattacctaccattaacactcat
cctctgactagtggtccacaccatgctgttcatcaccctcatttacttcccactgtgtta
cctggagtgcctactgcctccttacttggtggccacccacgactagagagtgctcatgcc
agcagcttgagccacttagcgctagcacaccagcaacaacaacagttgttacagcaccag
tcacctcatcttcttggacaagcccatccttctgcttcatataatcagcttggactttat
ccaattatttggcagtatccaaatggaacacatgcatactcaggacttggtttgccttct
tctaagtgggttcacccagaaaatgcagttaatgctgaagcttcattaaggaggaattct
cccagtccttggctacatcagcccacccctgtgacctcagcagatggtattggattactt
agtcacattcctgtcagaccttccagtgcagagcctcatcggcctcttaaaattacagcc
cattccagtccaccattgacaaaaactttagtagatcatcataaggaagaattagaaaga
aaagcttttatggaaccattacggtctgttgcatccacatcagccaaaaatgacctggat
ctaaataggtcacagactggaaaagattgtcacttacataggcattttgtggatccagta
ttaaatcagttacagaggccaccccaggagactggagagaggttaaacaaatacaaagag
gaacaccgtcgaattcttcaagaaagtattgatgttgctccctttacaactaaaatcaag
ggacttgagggtgagagagagaattattccagagtggcatcatcatcttccagtcctaaa
agccatatcatcaaacaagatatggatgtagaacgctcagtatcagatctttataaaatg
aagcactcagtgcctcagagtttaccccaaagtaactatttcactacattgtctaatagt
gtggtcaatgaaccaccaagatcatacccatccaaagaagtttcaaatatttacggtgat
aaacagagtaatgcccttgcagcggcagcagctaatcctcaaactctgacttcatttata
acatctctttcaaagcctccacctttgattaaacaccaaccagaaagtgaaggtttagta
ggcaagataccagaacatcttccacatcagattgcatctcactcagtaacaaccttcaga
aatgattgtaggagtcctacccatttgacagtttcttctacaaatacactccgcagtatg
cctgcattacatagagcaccagtatttcacccaccaatccatcacagcctggaaagaaag
gaaggcagctatagtagtctttcccctccaactttaactccggtgatgccagtaaatgct
ggtggtaaagttcaagaatcacagaagcctccaactctaatacccgaaccaaaagactcc
caggcaaattttaagagttcttcagaacagagtttgacggagatgtggagacctaataat
aacctcagcaaagagaaaactgaatggcatgtggagaaaagcagcggaaagttacaggct
gctatggcatctgtcattgtgcgtccatcttctagtacaaaaactgatagtatgccagca
atgcagttagcttctaaagatcgagttagtgaaagatcttcagctggggcacataaaaca
gattgcctcaaactagcagaagccggagaaactggaagaatcattttgccaaatgtgaat
tcagacagtgttcacacaaaatctgaaaaaaactttcaggctgtctcacagggcagtgtt
cccagttcagtcatgtctgctgtaaatacgatgtgtaataccaaaacggatgtaatcaca
tctgctgccgatactaccagtgtttccagctggggtggttcagaagtaatttcctcttta
tcaaataccattttggcctctacatcatcagaatgtgtatcttcaaaaagtgtcagtcag
ccagtggctcaaaaacaagaatgcaaggtcagcaccacagcaccagttacattagccagt
agtaagacaggaagtgttgttcaacccagttctgggttctcaggcacaactgattttatc
catttaaaaaagcacaaggcagcattggctgcagctcagtataaaagtagtaatgccagt
gagactgaacctaatgctataaaaaatcagacactttcagcctcccttcctctggatagc
actgtaatctgtagtacaattaacaaagcaaactctgtaggaaatgggcaagcttcccag
acaagtcaaccaaactaccatactaaactgaaaaaggcctggctcaccagacactcagaa
gaagataaaaatactaataaaatggaaaattcagggaattctgtatcagaaattattaag
ccatgttctgtcaacttaatagcctctacatctagtgatatacaaaatagtgtagatagt
aagatcatagttgataaatatgtaaaagatgataaagtcaacaggagaaaagccaaaaga
acttatgaatctggctctgaaagtggagactcagatgaaagtgaaagcaagtcagagcaa
aggactaaaagacaacctaagccaacttacaaaaagaagcaaaatgatttgcaaaagaga
aaaggtgaaatagaagaagatttgaaacccaatggagttctcagcaggagtgccaaagaa
agaagtaaactgaagttgcaaagcaacagtaatactggcattcctcgttcagtattgaaa
gattggcgtaaagtcaagaagctgaagcaaactggggaatcctttttacaggatgactcc
tgctgtgagatagggcctaatttacaaaagtgtcgagaatgtagacttattcgcagtaaa
aaaggagaagaaccagctcactcaccagtattttgtagattttactactttagacggttg
tcatttagtaaaaacggagtagttagaatagatggtttctcttctcctgaccaatatgat
gatgaagctatgagtttgtggacacatgaaaattttgaagatgatgaactagatatagag
acttctaaatatatcttggatataataggtgataagttctgtcaattagtaacatctgaa
aaaacagctttgtcctgggtgaaaaaggatgccaaaattgcctggaaaagagcagtgaga
ggagtccgggagatgtgtgatgcatgtgaagcaacattgtttaacattcactgggtctgc
caaaaatgtggatttgtggtctgcttagattgttacaaggcaaaggaaaggaagagttct
agagataaagaactatatgcttggatgaagtgtgtgaagggacagcctcatgatcacaaa
catttaatgccaacccaaattatacctggttctgttttgacagatcttctagatgccatg
cacactcttagggaaaaatatggtattaaatcccattgtcattgtactaacaaacagaat
ttacaagttggaaattttcctacaatgaatggtgtatctcaagttttacagaatgttctt
aatcacagtaataaaatttctctgtgcatgcctgagtctcagcagcaaaatactcctccg
aagtctgagaaaaatggtggcagcagcccagagagtgatgtaggcacagataacaagtta
actcctccagaatcccagtcaccactgcactggttagcagatcttgcagagcaaaaagcc
agagaggaaaaaaaagaaaacaaagaacttacccttgaaaaccaaattaaagaagaaaga
gaacaagacaactctgaatctccaaatggcagaacatcacctcttgtgtcccagaataat
gaacaaggctcaaccttacgggatttgctgactacaacagctggaaagctacgtgtgggg
tctacagatgctggcattgcctttgccccagtatattcaatgggagccccaagtagcaaa
agtggacggactatgcctaacattcttgatgacataattgcttcagttgttgaaaacaaa
attccaccaagtaaaacctccaagataaatgtaaaaccagagcttaaagaagagcctgaa
gaaagcataatatctgcagtggatgaaaataataaattatacagtgatataccacattct
tggatctgtgagaagcatattttatggcttaaggattataagaatagcagtaattggaag
cttttcaaagaatgttggaaacaaggacagcctgcagtggtttctggtgtgcataagaaa
atgaacattagcctatggaaggcggaatcaattagtcttgattttggagaccaccaagct
gatctcctgaactgcaaagatagcatcatttcaaatgccaatgttaaggaattctgggat
ggttttgaagaagtttcaaaacggcagaaaaacaagagtggagaaacagttgttttaaaa
ttgaaagactggccttcaggagaagacttcaagactatgatgccagcaagatacgaagat
cttttaaaaagtctgccattgccagaatattgtaatccagaaggaaaattcaatttggcc
tctcatttgccaggattttttgtacgtcctgatctaggacccaggttgtgcagtgcctat
ggtgtagttgctgctaaagatcatgatataggaacaacaaatctccatattgaagtttct
gatgttgtaaatatactagtttatgttggcatagcaaaaggaaatggcattctctcaaaa
gcaggaattctcaagaaatttgaggaagaagatttggatgacattttaaggaaaagattg
aaggactcaagtgaaatacctggtgctctgtggcatatttatgctgggaaagatgttgac
aagataagggaatttcttcaaaagatttcaaaagaacaaggccttgaagttctaccagaa
catgatccaatacgtgaccaaagttggtatgtgaacaaaaagctccgtcaaaggctgctt
gaagaatatggagtcagaacctgtactcttattcagttccttggtgatgctattgttttg
ccagcgggagcacttcatcaggttcagaattttcacagctgtattcaggtaactgaagat
tttgtgtctccagaacatcttgtagagtcatttcatttaacacaggaactgagacttttg
aaggaagaaatcaattatgatgataaactacaggttaaaaatattttgtatcatgcagtc
aaagaaatggtgagagccttgaagatacacgaggatgaagtagaggatatggaagaaaat
taa

DBGET integrated database retrieval system