KEGG   Homo sapiens (human): 221223Help
Entry
221223            CDS       T01001                                 

Gene name
CES5A, CAUXIN, CES4C1, CES5, CES7, HEL126
Definition
carboxylesterase 5A (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12.2
AA seq 575 aa AA seqDB search
MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVSED
CLYLNIYAPAHADTGSKLPVLVWFPGGAFKTGSASIFDGSALAAYEDVLVVVVQYRLGIF
GFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPM
AKGLFHKAIMESGVAIIPYLEAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILS
GSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIRDSLLDLLGDVFFVVPALITA
RYHRDAGAPVYFYEFRHRPQCFEDTKPAFVKADHADEVRFVFGGAFLKGDIVMFEGATEE
EKLLSRKMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWT
STIPLILSASDMLHSPLSSLTFLSLLQPFFFFCAP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaattgggtgcacccaggccagatcctaatttgggctatctgggtccttgca
gcccccaccaaagggccttctgctgaagggccacagaggaacaccaggctgggatggatt
cagggcaagcaagtcactgtgctgggaagccctgtgcctgtgaacgtgttcctcggagtc
ccctttgctgctcccccgctgggatccctgcgatttacgaacccgcagcctgcatcgccc
tgggataacttgcgagaagccacctcctaccctaatttgtgcctccagaactcagagtgg
ctgctcttagatcaacatatgctcaaggtgcattacccgaaattcggagtgtcagaagac
tgcctctacctgaacatctatgcgcctgcccacgccgatacaggctccaagctccccgtc
ttggtgtggttcccaggaggtgccttcaagactggctcagcctccatctttgatgggtcc
gccctggctgcctatgaggacgtgctggttgtggtcgtccagtaccggctaggaatattt
ggtttcttcaccacatgggatcagcatgctccggggaactgggccttcaaggaccaggtg
gctgctctgtcctgggtccagaagaacatcgagttcttcggtggggaccccagctctgtg
accatctttggcgagtccgcgggagccataagtgtttctagtcttatactgtctcccatg
gccaaaggcttattccacaaagccatcatggagagtggggtggccatcatcccttacctg
gaggcccatgattatgagaagagtgaggacctgcaggtggttgcacatttctgtggtaac
aatgcgtcagactctgaggccctgctgaggtgcctgaggacaaaaccctccaaggagctg
ctgaccctcagccagaaaacaaagtctttcactcgagtggttgatggtgctttctttcct
aatgagcctctagatctattgtctcagaaagcatttaaagcaattccttccatcatcgga
gtcaataaccacgagtgtggcttcctgctgcctatgaaggaggctcctgagatcctcagt
ggctccaacaagtcccttgccctccatctgatacaaaacatcctgcacatcccgcctcag
tatttgcaccttgtggctaatgaatacttccatgacaagcactccctgactgaaatccga
gacagtcttctggacttgcttggagatgtgttctttgtggtccctgcactgatcacagct
cgatatcacagagatgctggtgcacctgtctacttctatgagtttcggcaccggcctcag
tgctttgaagacacgaagccagcttttgtcaaagccgaccacgctgatgaagtccgcttt
gtgttcggtggtgccttcctgaagggggacattgttatgttcgaaggagccacggaggag
gagaagttactgagccggaagatgatgaaatactgggctacctttgctcgaaccgggaat
cctaatgggaacgacctgtctctgtggccagcttataatctgactgagcagtacctccag
ctggacttgaacatgagcctcggacagagactcaaagaaccgcgggtggatttttggacc
agcaccatccccctgatcctgtctgcctccgacatgctccacagtcctctttcttcctta
actttcctctctctcctccagcctttctttttcttttgtgctccttga

DBGET integrated database retrieval system