KEGG   Homo sapiens (human): 221395Help
Entry
221395            CDS       T01001                                 

Gene name
ADGRF5, GPR116, KPG_001
Definition
(RefSeq) adhesion G protein-coupled receptor F5
  KO
K08458  
G protein-coupled receptor 116
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    221395 (ADGRF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12.3
AA seq 1346 aa AA seqDB search
MKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSLHEHEPAGEEALRQKRAVATKSPTA
EEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWC
SCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNV
GFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPS
LELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSS
NVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVCKLILDIFEYE
CKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDI
DSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPI
SVSEGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWN
GTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKV
TFHTGSSSLPAAKEVNKKQVCYKHNFNASSVSWCSKTVDVCCHFTNAANNSVWSPSMKLN
LVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPESPIGGTITYKCVGSQWEEKRNDC
ISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLL
STVPTQVNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD
SPPLSFSQTNVQMSSMVIKSSHPETYQQRFVFPYFDLWGNVVIDKSYLENLQSDSSIVTM
AFPTLQAILAQDIQENNFAESLVMTTTVSHNTTMPFRISMTFKNNSPSGGETKCVFWNFR
LANNTGGWDSSGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGV
GFSILSLAACLVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYI
LCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPL
AISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITITIVVITKILRP
SIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKT
GTYNVSTPEATSSSLENSSSASSLLN
NT seq 4041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccccaaggagaaccactttgtgcctcatgtttattgtgatttattcttccaaa
gctgcactgaactggaattacgagtctactattcatcctttgagtcttcatgaacatgaa
ccagctggtgaagaggcactgaggcaaaaacgagccgttgccacaaaaagtcctacggct
gaagaatacactgttaatattgagatcagttttgaaaatgcatccttcctggatcctatc
aaagcctacttgaacagcctcagttttccaattcatgggaataacactgaccaaattacc
gacattttgagcataaatgtgacaacagtctgcagacctgctggaaatgaaatctggtgc
tcctgcgagacaggttatgggtggcctcgggaaaggtgtcttcacaatctcatttgtcaa
gagcgtgacgtcttcctcccagggcaccattgcagttgccttaaagaactgcctcccaat
ggacctttttgcctgcttcaggaagatgttaccctgaacatgagagtcagactaaatgta
ggctttcaagaagacctcatgaacacttcctccgccctctataggtcctacaagaccgac
ttggaaacagcgttccggaagggttacggaattttaccaggcttcaagggcgtgactgtg
acagggttcaagtctggaagtgtggttgtgacatatgaagtcaagactacaccaccatca
cttgagttaatacataaagccaatgaacaagttgtacagagcctcaatcagacctacaaa
atggactacaactcctttcaagcagttactatcaatgaaagcaatttctttgtcacacca
gaaatcatctttgaaggggacacagtcagtctggtgtgtgaaaaggaagttttgtcctcc
aatgtgtcttggcgctatgaagaacagcagttggaaatccagaacagcagcagattctcg
atttacaccgcacttttcaacaacatgacttcggtgtccaagctcaccatccacaacatc
actccaggtgatgcaggtgaatatgtttgcaaactgatattagacatttttgaatatgag
tgcaagaagaaaatagatgttatgcccatccaaattttggcaaatgaagaaatgaaggtg
atgtgcgacaacaatcctgtatctttgaactgctgcagtcagggtaatgttaattggagc
aaagtagaatggaagcaggaaggaaaaataaatattccaggaacccctgagacagacata
gattctagctgcagcagatacaccctcaaggctgatggaacccagtgcccaagcgggtcg
tctggaacaacagtcatctacacttgtgagttcatcagtgcctatggagccagaggcagt
gcaaacataaaagtgacattcatctctgtggccaatctaacaataaccccggacccaatt
tctgtttctgagggacaaaacttttctataaaatgcatcagtgatgtgagtaactatgat
gaggtttattggaacacttctgctggaattaaaatataccaaagattttataccacgagg
aggtatcttgatggagcagaatcagtactgacagtcaagacctcgaccagggagtggaat
ggaacctatcactgcatatttagatataagaattcatacagtattgcaaccaaagacgtc
attgttcacccgctgcctctaaagctgaacatcatggttgatcctttggaagctactgtt
tcatgcagtggttcccatcacatcaagtgctgcatagaggaggatggagactacaaagtt
actttccatacgggttcctcatcccttcctgctgcaaaagaagttaacaaaaaacaagtg
tgctacaaacacaatttcaatgcaagctcagtttcctggtgttcaaaaactgttgatgtg
tgttgtcactttaccaatgctgctaataattcagtctggagcccatctatgaagctgaat
ctggttcctggggaaaacatcacatgccaggatcccgtaataggtgtcggagagccgggg
aaagtcatccagaagctatgccggttctcaaacgttcccagcagccctgagagtcccatt
ggcgggaccatcacttacaaatgtgtaggctcccagtgggaggagaagagaaatgactgc
atctctgccccaataaacagtctgctccagatggctaaggctttgatcaagagcccctct
caggatgagatgctccctacatacctgaaggatctttctattagcatagacaaagcggaa
catgaaatcagctcttctcctgggagtctgggagccattattaacatccttgatctgctc
tcaacagttccaacccaagtaaattcagaaatgatgacgcacgtgctctctacggttaat
gtcatccttggcaagcccgtcttgaacacctggaaggttttacaacagcaatggaccaat
cagagttcacagctactacattcagtggaaagattttcccaagcattacagtcgggagat
agccctcctttgtccttctcccaaactaatgtgcagatgagcagcatggtaatcaagtcc
agccacccagaaacctatcaacagaggtttgttttcccatactttgacctctggggcaat
gtggtcattgacaagagctatctagaaaacttgcagtcggattcgtctattgtcaccatg
gctttcccaactctccaagccatccttgcccaggatatccaggaaaataactttgcagag
agcttagtgatgacaaccactgtcagccacaatacaactatgccattcaggatttcaatg
acttttaagaacaatagcccttcaggcggcgaaacgaagtgtgtcttctggaacttcagg
cttgccaacaacacaggggggtgggacagcagtgggtgctatgtagaagaaggtgatggg
gacaatgtcacctgtatctgtgaccacctaacatcattctccatcctcatgtcccctgac
tccccagatcctagttctctcctgggaatactcctggatattatttcttatgttggggtg
ggcttttccatcttgagcttggcagcctgtctagttgtggaagctgtggtgtggaaatcg
gtgaccaagaaccggacttcttatatgcgccacacctgcatagtgaatatcgctgcctcc
cttctggtcgccaacacctggttcattgtggtcgctgccatccaggacaatcgctacata
ctctgcaagacagcctgtgtggctgccaccttcttcatccacttcttctacctcagcgtc
ttcttctggatgctgacactgggcctcatgctgttctatcgcctggttttcattctgcat
gaaacaagcaggtccactcagaaagccattgccttctgtcttggctatggctgcccactt
gccatctcggtcatcacgctgggagccacccagccccgggaagtctatacgaggaagaat
gtctgttggctcaactgggaggacaccaaggccctgctggctttcgccatcccagcactg
atcattgtggtggtgaacataaccatcactattgtggtcatcaccaagatcctgaggcct
tccattggagacaagccatgcaagcaggagaagagcagcctgtttcagatcagcaagagc
attggggtcctcacaccactcttgggcctcacttggggttttggtctcaccactgtgttc
ccagggaccaaccttgtgttccatatcatatttgccatcctcaatgtcttccagggatta
ttcattttactctttggatgcctctgggatctgaaggtacaggaagctttgctgaataag
ttttcattgtcgagatggtcttcacagcactcaaagtcaacatccctgggttcatccaca
cctgtgttttctatgagttctccaatatcaaggagatttaacaatttgtttggtaaaaca
ggaacgtataatgtttccaccccagaagcaaccagctcatccctggaaaactcatccagt
gcttcttcgttgctcaactaa

DBGET integrated database retrieval system