KEGG   Homo sapiens (human): 2222Help
Entry
2222              CDS       T01001                                 

Gene name
FDFT1, DGPT, ERG9, SQS, SS
Definition
(RefSeq) farnesyl-diphosphate farnesyltransferase 1
  KO
K00801  farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    2222 (FDFT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.21  squalene synthase
     2222 (FDFT1)
Prenyltransferases [BR:hsa01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   2222 (FDFT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQS_PSY Octopine_DH
Motif
Other DBs
NCBI-GeneID: 2222
NCBI-ProteinID: NP_001274671
OMIM: 184420
HGNC: 3629
Ensembl: ENSG00000079459
Vega: OTTHUMG00000090801
Pharos: P37268(Tchem)
UniProt: P37268 Q6IAX1
Structure
PDB: 

Jmol
Position
8p23.1
AA seq 417 aa AA seqDB search
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQ
VLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVG
IGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYV
KKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTR
QIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgtgaaatgccttggccaccccgaagagttctacaacctggtgcgcttccgg
atcgggggcaagcggaaggtgatgcccaagatggaccaggactcgctcagcagcagcctg
aaaacttgctacaagtatctcaatcagaccagtcgcagtttcgcagctgttatccaggcg
ctggatggggaaatgcgcaacgcagtgtgcatattttatctggttctccgagctctggac
acactggaagatgacatgaccatcagtgtggaaaagaaggtcccgctgttacacaacttt
cactctttcctttaccaaccagactggcggttcatggagagcaaggagaaggatcgccag
gtgctggaggacttcccaacgatctcccttgagtttagaaatctggctgagaaataccaa
acagtgattgccgacatttgccggagaatgggcattgggatggcagagtttttggataag
catgtgacctctgaacaggagtgggacaagtactgccactatgttgctgggctggtcgga
attggcctttcccgtcttttctcagcctcagagtttgaagaccccttagttggtgaagat
acagaacgtgccaactctatgggcctgtttctgcagaaaacaaacatcatccgtgactat
ctggaagaccagcaaggaggaagagagttctggcctcaagaggtttggagcaggtatgtt
aagaagttaggggattttgctaagccggagaatattgacttggccgtgcagtgcctgaat
gaacttataaccaatgcactgcaccacatcccagatgtcatcacctacctttcgagactc
agaaaccagagtgtgtttaacttctgtgctattccacaggtgatggccattgccactttg
gctgcctgttataataaccagcaggtgttcaaaggggcagtgaagattcggaaagggcaa
gcagtgaccctgatgatggatgccaccaatatgccagctgtcaaagccatcatatatcag
tatatggaagagatttatcatagaatccccgactcagacccatcttctagcaaaacaagg
cagatcatctccaccatccggacgcagaatcttcccaactgtcagctgatttcccgaagc
cactactcccccatctacctgtcgtttgtcatgcttttggctgccctgagctggcagtac
ctgaccactctctcccaggtaacagaagactatgttcagactggagaacactga

DBGET integrated database retrieval system