KEGG   Homo sapiens (human): 2222Help
Entry
2222              CDS       T01001                                 

Gene name
FDFT1, DGPT, ERG9, SQS, SS
Definition
farnesyl-diphosphate farnesyltransferase 1 (EC:2.5.1.21)
Orthology
K00801  
farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:hsa00100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p23.1-p22
AA seq 417 aa AA seqDB search
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQ
VLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVG
IGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYV
KKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTR
QIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgtgaaatgccttggccaccccgaagagttctacaacctggtgcgcttccgg
atcgggggcaagcggaaggtgatgcccaagatggaccaggactcgctcagcagcagcctg
aaaacttgctacaagtatctcaatcagaccagtcgcagtttcgcagctgttatccaggcg
ctggatggggaaatgcgcaacgcagtgtgcatattttatctggttctccgagctctggac
acactggaagatgacatgaccatcagtgtggaaaagaaggtcccgctgttacacaacttt
cactctttcctttaccaaccagactggcggttcatggagagcaaggagaaggatcgccag
gtgctggaggacttcccaacgatctcccttgagtttagaaatctggctgagaaataccaa
acagtgattgccgacatttgccggagaatgggcattgggatggcagagtttttggataag
catgtgacctctgaacaggagtgggacaagtactgccactatgttgctgggctggtcgga
attggcctttcccgtcttttctcagcctcagagtttgaagaccccttagttggtgaagat
acagaacgtgccaactctatgggcctgtttctgcagaaaacaaacatcatccgtgactat
ctggaagaccagcaaggaggaagagagttctggcctcaagaggtttggagcaggtatgtt
aagaagttaggggattttgctaagccggagaatattgacttggccgtgcagtgcctgaat
gaacttataaccaatgcactgcaccacatcccagatgtcatcacctacctttcgagactc
agaaaccagagtgtgtttaacttctgtgctattccacaggtgatggccattgccactttg
gctgcctgttataataaccagcaggtgttcaaaggggcagtgaagattcggaaagggcaa
gcagtgaccctgatgatggatgccaccaatatgccagctgtcaaagccatcatatatcag
tatatggaagagatttatcatagaatccccgactcagacccatcttctagcaaaacaagg
cagatcatctccaccatccggacgcagaatcttcccaactgtcagctgatttcccgaagc
cactactcccccatctacctgtcgtttgtcatgcttttggctgccctgagctggcagtac
ctgaccactctctcccaggtaacagaagactatgttcagactggagaacactga

DBGET integrated database retrieval system