KEGG   Homo sapiens (human): 2224Help
Entry
2224              CDS       T01001                                 

Gene name
FDPS, FPPS, FPS, POROK9
Definition
(RefSeq) farnesyl diphosphate synthase
  KO
K00787  
farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Influenza A
HTLV-I infection
Module
C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Drug target
Alendronic acid (DG00783): 
Ibandronic acid (DG00785): 
Incadronic acid (DG01266): 
Minodronic acid hydrate: 
Pamidronic acid (DG00782): 
Risedronic acid (DG00786): 
Zoledronic acid (DG00787): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    2224 (FDPS)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    2224 (FDPS)
   05164 Influenza A
    2224 (FDPS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     2224 (FDPS)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     2224 (FDPS)
Prenyltransferases [BR:hsa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   2224 (FDPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P14324(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
1q22
AA seq 419 aa AA seqDB search
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtcccgctggttgagatctgtgggggtcttcctgctgccagccccctactgg
gcaccccgggagaggtggctgggttccctacggcggccctccctggtgcacgggtaccca
gtcctggcctggcacagtgcccgctgctggtgccaagcgtggacagaggaacctcgagcc
ctttgctcctccctcagaatgaacggagaccagaattcagatgtttatgcccaagaaaag
caggatttcgttcagcacttctcccagatcgttagggtgctgactgaggatgagatgggg
cacccagagataggagatgctattgcccggctcaaggaggtcctggagtacaatgccatt
ggaggcaagtataaccggggtttgacggtggtagtagcattccgggagctggtggagcca
aggaaacaggatgctgatagtctccagcgggcctggactgtgggctggtgtgtggaactg
ctgcaagctttcttcctggtggcagatgacatcatggattcatcccttacccgccgggga
cagatctgctggtatcagaagccgggcgtgggtttggatgccatcaatgatgctaacctc
ctggaagcatgtatctaccgcctgctgaagctctattgccgggagcagccctattacctg
aacctgatcgagctcttcctgcagagttcctatcagactgagattgggcagaccctggac
ctcctcacagccccccagggcaatgtggatcttgtcagattcactgaaaagaggtacaaa
tctattgtcaagtacaagacagctttctactccttctaccttcctatagctgcagccatg
tacatggcaggaattgatggcgagaaggagcacgccaatgccaagaagatcctgctggag
atgggggagttctttcagattcaggatgattaccttgacctctttggggaccccagtgtg
accggcaaaattggcactgacatccaggacaacaaatgcagctggctggtggttcagtgt
ctgcaacgggccactccagaacagtaccagatcctgaaggaaaattacgggcagaaggag
gctgagaaagtggcccgggtgaaggcgctatatgaggagctggatctgccagcagtgttc
ttgcaatatgaggaagacagttacagccacattatggctctcattgaacagtacgcagca
cccctgcccccagccgtctttctggggcttgcgcgcaaaatctacaagcggagaaagtga

DBGET integrated database retrieval system