KEGG   Homo sapiens (human): 222537Help
Entry
222537            CDS       T01001                                 

Gene name
HS3ST5, 3-OST-5, 3OST5, HS3OST5, NBLA04021
Definition
(RefSeq) heparan sulfate-glucosamine 3-sulfotransferase 5
  KO
K08104  
[heparan sulfate]-glucosamine 3-sulfotransferase 5 [EC:2.8.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    222537 (HS3ST5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.23  [heparan sulfate]-glucosamine 3-sulfotransferase 1
     222537 (HS3ST5)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   222537 (HS3ST5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8IZT8(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6q21-q22.1
AA seq 346 aa AA seqDB search
MLFKQQAWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPIEGRLGGARTQAEFPLRA
LQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKAS
QEIHFFDNDENYGKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLI
IVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLER
WLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNII
FNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctattcaaacagcaggcgtggctgagacagaagctcctggtgctgggaagccttgcc
gttgggagtctcctgtatctagtcgccagagttgggagcttggataggctacaacccatt
tgccccattgaaggtcgactgggtggagcccgcactcaggctgaattcccacttcgcgcc
ctgcagtttaagcgtggcctgctgcacgagttccggaagggcaacgcttccaaggagcag
gttcgcctccatgacctggtccagcagctccccaaggccattatcattggggtgaggaaa
ggaggcacaagggccctgcttgaaatgctgaacctacatccggcagtagtcaaagcctct
caagaaatccacttttttgataatgatgagaattatggtaagggcattgagtggtatagg
aaaaagatgcctttttcctaccctcagcaaatcacaattgaaaagagcccagcatatttt
atcacagaggaggttccagaaaggatttacaaaatgaactcatccatcaagttgttgatc
attgtcagggagccaaccacaagagctatttctgattatactcaggtgctagaggggaag
gagaggaagaacaaaacttattacaagtttgagaagctggccatagaccctaatacatgc
gaagtgaacacaaaatacaaagcagtaagaaccagcatctacaccaaacatctggaaagg
tggttgaaatactttccaattgagcaatttcatgtcgtcgatggagatcgcctcatcacg
gaacctctgccagaacttcagctcgtggagaagttcctaaatctgcctccaaggataagt
caatacaatttatacttcaatgctaccagagggttttactgcttgcggtttaatattatc
tttaataagtgcctggcgggcagcaaggggcgcattcatccagaggtggacccctctgtc
attactaaattgcgcaaattctttcatccttttaatcaaaaattttaccagatcactggg
aggacattgaactggccctaa

DBGET integrated database retrieval system